Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | K9B11_RS14175 | Genome accession | NZ_CP083728 |
| Coordinates | 2830464..2830934 (+) | Length | 156 a.a. |
| NCBI ID | WP_000934770.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain MR254 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2805009..2837114 | 2830464..2830934 | within | 0 |
Gene organization within MGE regions
Location: 2805009..2837114
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| K9B11_RS14010 (K9B11_14010) | groES | 2805009..2805293 (+) | 285 | WP_000917289.1 | co-chaperone GroES | - |
| K9B11_RS14015 (K9B11_14015) | groL | 2805369..2806985 (+) | 1617 | WP_000240645.1 | chaperonin GroEL | - |
| K9B11_RS14020 (K9B11_14020) | - | 2807080..2807626 (-) | 547 | Protein_2724 | site-specific integrase | - |
| K9B11_RS14025 (K9B11_14025) | - | 2807687..2807899 (+) | 213 | WP_000128898.1 | LuxR C-terminal-related transcriptional regulator | - |
| K9B11_RS14030 (K9B11_14030) | - | 2807896..2808486 (+) | 591 | WP_224433976.1 | terminase small subunit | - |
| K9B11_RS14035 (K9B11_14035) | - | 2808805..2809241 (+) | 437 | Protein_2727 | hypothetical protein | - |
| K9B11_RS14040 (K9B11_14040) | - | 2809347..2809790 (+) | 444 | WP_000022887.1 | GNAT family N-acetyltransferase | - |
| K9B11_RS14045 (K9B11_14045) | - | 2810643..2811950 (-) | 1308 | WP_263479616.1 | TrkH family potassium uptake protein | - |
| K9B11_RS14050 (K9B11_14050) | - | 2812111..2813022 (+) | 912 | WP_000825510.1 | iron-hydroxamate ABC transporter substrate-binding protein | - |
| K9B11_RS14055 (K9B11_14055) | - | 2813084..2813929 (+) | 846 | WP_000812008.1 | class I SAM-dependent methyltransferase | - |
| K9B11_RS14060 (K9B11_14060) | - | 2814301..2815524 (-) | 1224 | WP_000206638.1 | ArgE/DapE family deacylase | - |
| K9B11_RS14065 (K9B11_14065) | lukH | 2815959..2817014 (+) | 1056 | WP_224433977.1 | bi-component leukocidin LukGH subunit H | - |
| K9B11_RS14070 (K9B11_14070) | lukG | 2817036..2818052 (+) | 1017 | WP_000595324.1 | bi-component leukocidin LukGH subunit G | - |
| K9B11_RS14075 (K9B11_14075) | sph | 2818290..2819114 (-) | 825 | Protein_2735 | sphingomyelin phosphodiesterase | - |
| K9B11_RS14080 (K9B11_14080) | - | 2819171..2820208 (-) | 1038 | WP_000857191.1 | tyrosine-type recombinase/integrase | - |
| K9B11_RS14085 (K9B11_14085) | - | 2820267..2820731 (-) | 465 | WP_000825947.1 | hypothetical protein | - |
| K9B11_RS14090 (K9B11_14090) | - | 2820831..2821013 (-) | 183 | WP_000705248.1 | hypothetical protein | - |
| K9B11_RS14095 (K9B11_14095) | - | 2821058..2821915 (-) | 858 | WP_224433978.1 | HIRAN domain-containing protein | - |
| K9B11_RS14100 (K9B11_14100) | - | 2821927..2822643 (-) | 717 | WP_001083967.1 | LexA family transcriptional regulator | - |
| K9B11_RS14105 (K9B11_14105) | - | 2822807..2823049 (+) | 243 | WP_000639927.1 | DUF739 family protein | - |
| K9B11_RS14110 (K9B11_14110) | - | 2823063..2823323 (+) | 261 | WP_000435341.1 | transcriptional regulator | - |
| K9B11_RS14115 (K9B11_14115) | - | 2823347..2823886 (-) | 540 | WP_000351243.1 | hypothetical protein | - |
| K9B11_RS14120 (K9B11_14120) | - | 2823943..2824698 (+) | 756 | WP_224433979.1 | phage antirepressor KilAC domain-containing protein | - |
| K9B11_RS14125 (K9B11_14125) | - | 2824714..2824911 (+) | 198 | WP_001148861.1 | hypothetical protein | - |
| K9B11_RS14130 (K9B11_14130) | - | 2824942..2825082 (+) | 141 | WP_000939496.1 | hypothetical protein | - |
| K9B11_RS14135 (K9B11_14135) | - | 2825097..2825729 (-) | 633 | WP_000275058.1 | hypothetical protein | - |
| K9B11_RS14140 (K9B11_14140) | - | 2825788..2826108 (+) | 321 | WP_001120197.1 | DUF771 domain-containing protein | - |
| K9B11_RS14145 (K9B11_14145) | - | 2826105..2826266 (+) | 162 | WP_000066020.1 | DUF1270 domain-containing protein | - |
| K9B11_RS14150 (K9B11_14150) | - | 2826359..2826619 (+) | 261 | WP_000291489.1 | DUF1108 family protein | - |
| K9B11_RS14155 (K9B11_14155) | - | 2826628..2826891 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| K9B11_RS14160 (K9B11_14160) | - | 2826900..2828843 (+) | 1944 | WP_000700562.1 | AAA family ATPase | - |
| K9B11_RS14165 (K9B11_14165) | - | 2828845..2829765 (+) | 921 | WP_000138481.1 | recombinase RecT | - |
| K9B11_RS14170 (K9B11_14170) | - | 2829846..2830463 (+) | 618 | WP_071621397.1 | MBL fold metallo-hydrolase | - |
| K9B11_RS14175 (K9B11_14175) | ssbA | 2830464..2830934 (+) | 471 | WP_000934770.1 | single-stranded DNA-binding protein | Machinery gene |
| K9B11_RS14180 (K9B11_14180) | - | 2830964..2831848 (+) | 885 | WP_000148301.1 | DnaD domain protein | - |
| K9B11_RS14185 (K9B11_14185) | - | 2831855..2832073 (+) | 219 | WP_000338528.1 | hypothetical protein | - |
| K9B11_RS14190 (K9B11_14190) | - | 2832082..2832486 (+) | 405 | WP_000401978.1 | RusA family crossover junction endodeoxyribonuclease | - |
| K9B11_RS14195 (K9B11_14195) | - | 2832499..2832867 (+) | 369 | WP_000101274.1 | SA1788 family PVL leukocidin-associated protein | - |
| K9B11_RS14200 (K9B11_14200) | - | 2832871..2833113 (+) | 243 | WP_000131366.1 | SAV1978 family virulence-associated passenger protein | - |
| K9B11_RS14205 (K9B11_14205) | - | 2833178..2833627 (+) | 450 | WP_000982711.1 | YopX family protein | - |
| K9B11_RS14210 (K9B11_14210) | - | 2833624..2834133 (+) | 510 | WP_001105598.1 | hypothetical protein | - |
| K9B11_RS14215 (K9B11_14215) | - | 2834130..2834540 (+) | 411 | WP_000197968.1 | hypothetical protein | - |
| K9B11_RS14220 (K9B11_14220) | - | 2834533..2834658 (+) | 126 | Protein_2764 | DUF1024 family protein | - |
| K9B11_RS14225 (K9B11_14225) | - | 2835014..2835550 (+) | 537 | WP_001066444.1 | dUTPase | - |
| K9B11_RS14230 (K9B11_14230) | - | 2835587..2835793 (+) | 207 | WP_000195820.1 | DUF1381 domain-containing protein | - |
| K9B11_RS14235 (K9B11_14235) | rinB | 2835790..2835939 (+) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| K9B11_RS14240 (K9B11_14240) | - | 2835939..2836139 (+) | 201 | WP_000265041.1 | DUF1514 family protein | - |
| K9B11_RS14245 (K9B11_14245) | - | 2836167..2836583 (+) | 417 | WP_000590126.1 | hypothetical protein | - |
| K9B11_RS14250 (K9B11_14250) | - | 2836815..2837114 (+) | 300 | WP_000988336.1 | HNH endonuclease | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17713.63 Da Isoelectric Point: 5.2672
>NTDB_id=607544 K9B11_RS14175 WP_000934770.1 2830464..2830934(+) (ssbA) [Staphylococcus aureus strain MR254]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANVPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANVPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=607544 K9B11_RS14175 WP_000934770.1 2830464..2830934(+) (ssbA) [Staphylococcus aureus strain MR254]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGTTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGTTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |