Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   LAC65_RS11220 Genome accession   NZ_CP083448
Coordinates   2356731..2357192 (+) Length   153 a.a.
NCBI ID   WP_224144774.1    Uniprot ID   -
Organism   Pantoea eucrina strain XL123     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2312770..2362420 2356731..2357192 within 0


Gene organization within MGE regions


Location: 2312770..2362420
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LAC65_RS10875 (LAC65_10875) - 2312770..2313927 (+) 1158 WP_224144715.1 tyrosine-type recombinase/integrase -
  LAC65_RS10880 (LAC65_10880) - 2314283..2314660 (+) 378 WP_224144716.1 hypothetical protein -
  LAC65_RS10885 (LAC65_10885) - 2314929..2315246 (-) 318 WP_224144717.1 phage repressor protein -
  LAC65_RS10890 (LAC65_10890) - 2315246..2315485 (-) 240 WP_224144718.1 DNA polymerase V -
  LAC65_RS10895 (LAC65_10895) - 2315725..2318055 (-) 2331 WP_224144719.1 hypothetical protein -
  LAC65_RS10900 (LAC65_10900) - 2318113..2320590 (-) 2478 WP_224144720.1 host specificity factor TipJ family phage tail protein -
  LAC65_RS10905 (LAC65_10905) - 2320577..2321104 (-) 528 WP_224144721.1 HNH endonuclease signature motif containing protein -
  LAC65_RS10910 (LAC65_10910) - 2321179..2321568 (-) 390 WP_224144863.1 NlpC/P60 family protein -
  LAC65_RS10915 (LAC65_10915) - 2321582..2322052 (-) 471 WP_224144722.1 hypothetical protein -
  LAC65_RS10920 (LAC65_10920) - 2322052..2322549 (-) 498 WP_224144723.1 hypothetical protein -
  LAC65_RS10925 (LAC65_10925) - 2322591..2322821 (-) 231 WP_224144724.1 hypothetical protein -
  LAC65_RS10930 (LAC65_10930) - 2322830..2326267 (-) 3438 WP_224144725.1 tape measure protein -
  LAC65_RS10935 (LAC65_10935) - 2326326..2326826 (-) 501 WP_082032636.1 type VI secretion system-associated protein TagO -
  LAC65_RS10940 (LAC65_10940) - 2326899..2327573 (-) 675 WP_224144864.1 DUF6246 family protein -
  LAC65_RS10945 (LAC65_10945) - 2327626..2328375 (-) 750 WP_224144726.1 Ig-like domain-containing protein -
  LAC65_RS10950 (LAC65_10950) - 2328443..2328826 (-) 384 WP_224144727.1 hypothetical protein -
  LAC65_RS10955 (LAC65_10955) - 2328823..2329191 (-) 369 WP_224144728.1 HK97 gp10 family phage protein -
  LAC65_RS10960 (LAC65_10960) - 2329194..2329541 (-) 348 WP_224144729.1 hypothetical protein -
  LAC65_RS10965 (LAC65_10965) - 2329541..2330185 (-) 645 WP_224144730.1 NUMOD3 domain-containing DNA-binding protein -
  LAC65_RS10970 (LAC65_10970) - 2330355..2330732 (-) 378 WP_224144731.1 DUF7370 family protein -
  LAC65_RS10975 (LAC65_10975) - 2330735..2331100 (-) 366 WP_224144732.1 hypothetical protein -
  LAC65_RS10980 (LAC65_10980) - 2331110..2332177 (-) 1068 WP_224144733.1 major capsid protein -
  LAC65_RS10985 (LAC65_10985) - 2332188..2332622 (-) 435 WP_224144734.1 hypothetical protein -
  LAC65_RS10990 (LAC65_10990) - 2332627..2334024 (-) 1398 WP_224144735.1 DUF2213 domain-containing protein -
  LAC65_RS10995 (LAC65_10995) - 2334049..2335008 (-) 960 WP_224144865.1 phage minor head protein -
  LAC65_RS11000 (LAC65_11000) - 2334956..2336413 (-) 1458 WP_224144736.1 DUF1073 domain-containing protein -
  LAC65_RS11005 (LAC65_11005) - 2336425..2337888 (-) 1464 WP_224144737.1 DNA-packaging protein -
  LAC65_RS11010 (LAC65_11010) - 2337875..2338354 (-) 480 WP_224144738.1 DUF2280 domain-containing protein -
  LAC65_RS11015 (LAC65_11015) - 2338386..2339021 (-) 636 WP_224144739.1 putative metallopeptidase -
  LAC65_RS11020 (LAC65_11020) - 2339040..2339234 (-) 195 WP_224144740.1 hypothetical protein -
  LAC65_RS11025 (LAC65_11025) - 2339227..2339382 (-) 156 WP_224144741.1 hypothetical protein -
  LAC65_RS11030 (LAC65_11030) - 2339503..2339907 (-) 405 WP_224144742.1 hypothetical protein -
  LAC65_RS11035 (LAC65_11035) - 2339911..2340441 (-) 531 WP_224144743.1 Rha family transcriptional regulator -
  LAC65_RS11040 (LAC65_11040) - 2340617..2340787 (-) 171 WP_199560435.1 hypothetical protein -
  LAC65_RS11045 (LAC65_11045) - 2340926..2341198 (-) 273 WP_224144744.1 hypothetical protein -
  LAC65_RS11050 (LAC65_11050) - 2341195..2341539 (-) 345 WP_224144745.1 hypothetical protein -
  LAC65_RS11055 (LAC65_11055) - 2341536..2342045 (-) 510 WP_224144746.1 HNH endonuclease -
  LAC65_RS11060 (LAC65_11060) - 2342042..2342515 (-) 474 WP_224144747.1 glycoside hydrolase family protein -
  LAC65_RS11065 (LAC65_11065) - 2342512..2342814 (-) 303 WP_039379266.1 hypothetical protein -
  LAC65_RS11070 (LAC65_11070) - 2342801..2343196 (-) 396 WP_039379268.1 hypothetical protein -
  LAC65_RS11075 (LAC65_11075) - 2343567..2344334 (-) 768 WP_224144748.1 antitermination protein -
  LAC65_RS11080 (LAC65_11080) - 2344334..2344741 (-) 408 WP_224144749.1 hypothetical protein -
  LAC65_RS18290 (LAC65_11085) - 2344710..2344934 (-) 225 WP_224144750.1 YlcG family protein -
  LAC65_RS11090 (LAC65_11090) - 2344849..2345217 (-) 369 WP_224144751.1 RusA family crossover junction endodeoxyribonuclease -
  LAC65_RS11095 (LAC65_11095) - 2345214..2345504 (-) 291 WP_039379280.1 DUF1364 domain-containing protein -
  LAC65_RS11100 (LAC65_11100) - 2345497..2345616 (-) 120 WP_224144752.1 protein NinF -
  LAC65_RS11105 (LAC65_11105) - 2345609..2345974 (-) 366 WP_224144753.1 phage protein NinX family protein -
  LAC65_RS11110 (LAC65_11110) - 2345974..2346249 (-) 276 WP_224144754.1 hypothetical protein -
  LAC65_RS11115 (LAC65_11115) - 2346323..2346772 (-) 450 WP_224144755.1 recombination protein NinB -
  LAC65_RS11120 (LAC65_11120) - 2346775..2346954 (-) 180 WP_224144756.1 hypothetical protein -
  LAC65_RS11125 (LAC65_11125) - 2346951..2347259 (-) 309 WP_224144757.1 hypothetical protein -
  LAC65_RS11130 (LAC65_11130) - 2347256..2347597 (-) 342 WP_224144758.1 hypothetical protein -
  LAC65_RS11135 (LAC65_11135) - 2347594..2347845 (-) 252 WP_224144759.1 hypothetical protein -
  LAC65_RS11140 (LAC65_11140) - 2347842..2349725 (-) 1884 WP_224144760.1 toprim domain-containing protein -
  LAC65_RS11145 (LAC65_11145) - 2349834..2350706 (-) 873 WP_224144761.1 replication protein -
  LAC65_RS11150 (LAC65_11150) - 2350699..2350842 (-) 144 WP_200889498.1 hypothetical protein -
  LAC65_RS11155 (LAC65_11155) - 2350880..2351182 (-) 303 WP_224144762.1 CII family transcriptional regulator -
  LAC65_RS11160 (LAC65_11160) - 2351295..2351483 (-) 189 WP_078805206.1 Cro/CI family transcriptional regulator -
  LAC65_RS11165 (LAC65_11165) - 2351589..2352299 (+) 711 WP_224144763.1 LexA family protein -
  LAC65_RS11170 (LAC65_11170) - 2352422..2353450 (+) 1029 WP_224144764.1 hypothetical protein -
  LAC65_RS11175 (LAC65_11175) - 2353806..2354081 (+) 276 WP_224144765.1 hypothetical protein -
  LAC65_RS11180 (LAC65_11180) - 2354089..2354298 (+) 210 WP_224144766.1 hypothetical protein -
  LAC65_RS11185 (LAC65_11185) - 2354293..2354496 (-) 204 WP_224144767.1 hypothetical protein -
  LAC65_RS11190 (LAC65_11190) - 2354730..2354891 (+) 162 WP_224144768.1 hypothetical protein -
  LAC65_RS11195 (LAC65_11195) - 2354910..2355215 (+) 306 WP_224144769.1 hypothetical protein -
  LAC65_RS18295 (LAC65_11200) - 2355365..2355502 (+) 138 WP_224144770.1 protease FtsH-inhibitory lysogeny factor CIII -
  LAC65_RS11205 (LAC65_11205) - 2355499..2355696 (+) 198 WP_224144771.1 DUF5444 family protein -
  LAC65_RS11210 (LAC65_11210) - 2355686..2355841 (+) 156 WP_224144772.1 hypothetical protein -
  LAC65_RS11215 (LAC65_11215) - 2355856..2356731 (+) 876 WP_224144773.1 ATP-binding protein -
  LAC65_RS11220 (LAC65_11220) ssb 2356731..2357192 (+) 462 WP_224144774.1 single-stranded DNA-binding protein Machinery gene
  LAC65_RS11225 (LAC65_11225) - 2357218..2357538 (+) 321 WP_224144775.1 hypothetical protein -
  LAC65_RS11230 (LAC65_11230) - 2357580..2358197 (+) 618 WP_224144776.1 hypothetical protein -
  LAC65_RS11235 (LAC65_11235) - 2358194..2358457 (+) 264 WP_224144777.1 hypothetical protein -
  LAC65_RS11240 (LAC65_11240) - 2358895..2359137 (+) 243 WP_224144778.1 hypothetical protein -
  LAC65_RS11245 (LAC65_11245) - 2359176..2359448 (+) 273 WP_224144779.1 DUF5405 family protein -
  LAC65_RS11250 (LAC65_11250) - 2359792..2359986 (+) 195 WP_039379359.1 helix-turn-helix transcriptional regulator -
  LAC65_RS11255 (LAC65_11255) - 2360052..2361899 (-) 1848 WP_420852408.1 3'-5' exonuclease -
  LAC65_RS11260 (LAC65_11260) - 2362175..2362420 (+) 246 WP_039385596.1 DUF2543 family protein -

Sequence

Protein


Download         Length: 153 a.a.        Molecular weight: 16913.76 Da        Isoelectric Point: 5.9459

>NTDB_id=605938 LAC65_RS11220 WP_224144774.1 2356731..2357192(+) (ssb) [Pantoea eucrina strain XL123]
MASRGVNKMILLGNLGKDPEVRYQPSGGAVANLTVATSEQWRDKSTGENKEATEWHRVVIFGKLAEVAGEYLRKGSQVYI
EGQLRTRKWQAQDGSEKYTTEIVVNVGGTLQMLGGKQESGQGNRTQQNQQRTGNSSPQVSNEPPMDFDEEPPF

Nucleotide


Download         Length: 462 bp        

>NTDB_id=605938 LAC65_RS11220 WP_224144774.1 2356731..2357192(+) (ssb) [Pantoea eucrina strain XL123]
ATGGCAAGTCGTGGTGTGAACAAAATGATTTTATTGGGCAATCTCGGGAAGGATCCGGAGGTTCGCTATCAGCCCTCAGG
TGGAGCAGTTGCAAATCTGACAGTAGCCACTTCAGAGCAGTGGCGCGACAAGTCAACCGGAGAGAACAAAGAGGCAACCG
AGTGGCATCGCGTGGTCATCTTCGGAAAGCTCGCAGAAGTGGCTGGCGAATATCTGCGAAAAGGATCGCAGGTTTACATC
GAAGGTCAGCTGCGCACACGGAAGTGGCAGGCGCAGGACGGCTCAGAAAAGTACACCACTGAGATAGTCGTCAACGTTGG
CGGAACGCTGCAGATGTTGGGCGGAAAGCAGGAAAGTGGACAGGGGAACCGTACGCAGCAAAATCAGCAGCGCACTGGGA
ACTCCAGCCCACAGGTGAGTAATGAACCGCCAATGGACTTCGACGAAGAACCCCCATTCTGA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(6-109)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

61.017

100

0.706
  ssb Glaesserella parasuis strain SC1401

50.829

100

0.601
  ssb Neisseria meningitidis MC58

44.444

100

0.444
  ssb Neisseria gonorrhoeae MS11

44.444

100

0.444