NTDB

Overview

Name	comGD	Type	Machinery gene
Locus tag	K9864_RS13230	Genome accession	NZ_CP083436
Coordinates	2663767..2664204 (-)	Length	145 a.a.
NCBI ID	WP_007612572.1	Uniprot ID	-
Organism	Bacillus velezensis strain HC-8
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2658767..2669204

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
K9864_RS13180 (K9864_13085)	sinI	2659150..2659323 (+)	174	WP_014418369.1	anti-repressor SinI	Regulator
K9864_RS13185 (K9864_13090)	sinR	2659357..2659692 (+)	336	WP_003153104.1	transcriptional regulator SinR	Regulator
K9864_RS13190 (K9864_13095)	tasA	2659740..2660525 (-)	786	WP_007408329.1	biofilm matrix protein TasA	-
K9864_RS13195 (K9864_13100)	sipW	2660590..2661174 (-)	585	WP_014418370.1	signal peptidase I SipW	-
K9864_RS13200 (K9864_13105)	tapA	2661146..2661817 (-)	672	WP_014418371.1	amyloid fiber anchoring/assembly protein TapA	-
K9864_RS13205 (K9864_13110)	-	2662076..2662405 (+)	330	WP_014418372.1	DUF3889 domain-containing protein	-
K9864_RS13210 (K9864_13115)	-	2662446..2662625 (-)	180	WP_003153093.1	YqzE family protein	-
K9864_RS13215 (K9864_13120)	comGG	2662682..2663059 (-)	378	WP_014418373.1	competence type IV pilus minor pilin ComGG	Machinery gene
K9864_RS13220 (K9864_13125)	comGF	2663060..2663560 (-)	501	WP_014418374.1	competence type IV pilus minor pilin ComGF	-
K9864_RS13225 (K9864_13130)	comGE	2663469..2663783 (-)	315	WP_032863566.1	competence type IV pilus minor pilin ComGE	Machinery gene
K9864_RS13230 (K9864_13135)	comGD	2663767..2664204 (-)	438	WP_007612572.1	competence type IV pilus minor pilin ComGD	Machinery gene
K9864_RS13235 (K9864_13140)	comGC	2664194..2664502 (-)	309	WP_014418376.1	competence type IV pilus major pilin ComGC	Machinery gene
K9864_RS13240 (K9864_13145)	comGB	2664507..2665544 (-)	1038	WP_014418377.1	competence type IV pilus assembly protein ComGB	Machinery gene
K9864_RS13245 (K9864_13150)	comGA	2665531..2666601 (-)	1071	WP_014418378.1	competence type IV pilus ATPase ComGA	Machinery gene
K9864_RS13250 (K9864_13155)	-	2666794..2667744 (-)	951	WP_014418379.1	magnesium transporter CorA family protein	-
K9864_RS13255 (K9864_13160)	-	2667889..2669190 (+)	1302	WP_029973873.1	hemolysin family protein	-

Sequence

Protein

Download Length: 145 a.a. Molecular weight: 16254.76 Da Isoelectric Point: 10.1850

                                >NTDB_id=605794 K9864_RS13230 WP_007612572.1 2663767..2664204(-) (comGD) [Bacillus velezensis strain HC-8]

MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK

LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide

Download Length: 438 bp

                                >NTDB_id=605794 K9864_RS13230 WP_007612572.1 2663767..2664204(-) (comGD) [Bacillus velezensis strain HC-8]

TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTACTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT

GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA

TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA

CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCACATTACGCTTGTGACTTTACCGGAGAGCCTTGA

ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATACAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT

ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(5-31)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGD	Bacillus subtilis subsp. subtilis str. 168	55.479	100	0.559

Detailed information NTG0605794