Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   K9864_RS13180 Genome accession   NZ_CP083436
Coordinates   2659150..2659323 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain HC-8     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2654150..2664323
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K9864_RS13165 (K9864_13070) gcvT 2654963..2656063 (-) 1101 WP_014418366.1 glycine cleavage system aminomethyltransferase GcvT -
  K9864_RS13170 (K9864_13075) - 2656487..2658157 (+) 1671 WP_021494309.1 DEAD/DEAH box helicase -
  K9864_RS13175 (K9864_13080) - 2658179..2658973 (+) 795 WP_014418368.1 YqhG family protein -
  K9864_RS13180 (K9864_13085) sinI 2659150..2659323 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  K9864_RS13185 (K9864_13090) sinR 2659357..2659692 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  K9864_RS13190 (K9864_13095) tasA 2659740..2660525 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  K9864_RS13195 (K9864_13100) sipW 2660590..2661174 (-) 585 WP_014418370.1 signal peptidase I SipW -
  K9864_RS13200 (K9864_13105) tapA 2661146..2661817 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  K9864_RS13205 (K9864_13110) - 2662076..2662405 (+) 330 WP_014418372.1 DUF3889 domain-containing protein -
  K9864_RS13210 (K9864_13115) - 2662446..2662625 (-) 180 WP_003153093.1 YqzE family protein -
  K9864_RS13215 (K9864_13120) comGG 2662682..2663059 (-) 378 WP_014418373.1 competence type IV pilus minor pilin ComGG Machinery gene
  K9864_RS13220 (K9864_13125) comGF 2663060..2663560 (-) 501 WP_014418374.1 competence type IV pilus minor pilin ComGF -
  K9864_RS13225 (K9864_13130) comGE 2663469..2663783 (-) 315 WP_032863566.1 competence type IV pilus minor pilin ComGE Machinery gene
  K9864_RS13230 (K9864_13135) comGD 2663767..2664204 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=605790 K9864_RS13180 WP_014418369.1 2659150..2659323(+) (sinI) [Bacillus velezensis strain HC-8]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=605790 K9864_RS13180 WP_014418369.1 2659150..2659323(+) (sinI) [Bacillus velezensis strain HC-8]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719