Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   K9864_RS13225 Genome accession   NZ_CP083436
Coordinates   2663469..2663783 (-) Length   104 a.a.
NCBI ID   WP_032863566.1    Uniprot ID   -
Organism   Bacillus velezensis strain HC-8     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2658469..2668783
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K9864_RS13180 (K9864_13085) sinI 2659150..2659323 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  K9864_RS13185 (K9864_13090) sinR 2659357..2659692 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  K9864_RS13190 (K9864_13095) tasA 2659740..2660525 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  K9864_RS13195 (K9864_13100) sipW 2660590..2661174 (-) 585 WP_014418370.1 signal peptidase I SipW -
  K9864_RS13200 (K9864_13105) tapA 2661146..2661817 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  K9864_RS13205 (K9864_13110) - 2662076..2662405 (+) 330 WP_014418372.1 DUF3889 domain-containing protein -
  K9864_RS13210 (K9864_13115) - 2662446..2662625 (-) 180 WP_003153093.1 YqzE family protein -
  K9864_RS13215 (K9864_13120) comGG 2662682..2663059 (-) 378 WP_014418373.1 competence type IV pilus minor pilin ComGG Machinery gene
  K9864_RS13220 (K9864_13125) comGF 2663060..2663560 (-) 501 WP_014418374.1 competence type IV pilus minor pilin ComGF -
  K9864_RS13225 (K9864_13130) comGE 2663469..2663783 (-) 315 WP_032863566.1 competence type IV pilus minor pilin ComGE Machinery gene
  K9864_RS13230 (K9864_13135) comGD 2663767..2664204 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  K9864_RS13235 (K9864_13140) comGC 2664194..2664502 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  K9864_RS13240 (K9864_13145) comGB 2664507..2665544 (-) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  K9864_RS13245 (K9864_13150) comGA 2665531..2666601 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  K9864_RS13250 (K9864_13155) - 2666794..2667744 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11920.92 Da        Isoelectric Point: 5.8321

>NTDB_id=605793 K9864_RS13225 WP_032863566.1 2663469..2663783(-) (comGE) [Bacillus velezensis strain HC-8]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMMTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPDVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=605793 K9864_RS13225 WP_032863566.1 2663469..2663783(-) (comGE) [Bacillus velezensis strain HC-8]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACGCTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGATGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGATGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGTGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

44.348

100

0.49