Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | LAE57_RS13665 | Genome accession | NZ_CP083434 |
| Coordinates | 2788419..2788889 (+) | Length | 156 a.a. |
| NCBI ID | WP_000934772.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain DC.RB_015 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 2765845..2793710 | 2788419..2788889 | within | 0 |
Gene organization within MGE regions
Location: 2765845..2793710
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LAE57_RS13495 (LAE57_13455) | - | 2766533..2766799 (-) | 267 | Protein_2619 | DUF6978 family protein | - |
| LAE57_RS13500 (LAE57_13460) | istA | 2766890..2768182 (+) | 1293 | WP_000777467.1 | IS21 family transposase | - |
| LAE57_RS13505 (LAE57_13465) | - | 2768175..2768291 (+) | 117 | WP_202421379.1 | ATP-binding protein | - |
| LAE57_RS13510 (LAE57_13470) | - | 2768327..2768611 (+) | 285 | WP_000134547.1 | hypothetical protein | - |
| LAE57_RS13515 (LAE57_13475) | - | 2768762..2769082 (+) | 321 | WP_000805732.1 | DUF961 family protein | - |
| LAE57_RS13520 (LAE57_13480) | - | 2769096..2769398 (+) | 303 | WP_000386891.1 | hypothetical protein | - |
| LAE57_RS13525 (LAE57_13485) | - | 2769573..2770664 (+) | 1092 | WP_000172943.1 | replication initiation factor domain-containing protein | - |
| LAE57_RS13530 (LAE57_13490) | - | 2770725..2771780 (+) | 1056 | WP_000692005.1 | conjugal transfer protein | - |
| LAE57_RS13535 (LAE57_13495) | - | 2771785..2772045 (+) | 261 | WP_000015644.1 | TcpD family membrane protein | - |
| LAE57_RS13540 (LAE57_13500) | - | 2772057..2772440 (+) | 384 | WP_000358144.1 | TcpE family conjugal transfer membrane protein | - |
| LAE57_RS13545 (LAE57_13505) | - | 2772475..2774970 (+) | 2496 | WP_001049264.1 | ATP-binding protein | - |
| LAE57_RS13550 (LAE57_13510) | - | 2775024..2776382 (+) | 1359 | WP_031883303.1 | FtsK/SpoIIIE domain-containing protein | - |
| LAE57_RS13555 (LAE57_13515) | - | 2776545..2777582 (-) | 1038 | WP_000857191.1 | tyrosine-type recombinase/integrase | - |
| LAE57_RS13560 (LAE57_13520) | - | 2777641..2778105 (-) | 465 | WP_000825947.1 | hypothetical protein | - |
| LAE57_RS13565 (LAE57_13525) | - | 2778205..2778387 (-) | 183 | WP_000705248.1 | hypothetical protein | - |
| LAE57_RS13570 (LAE57_13530) | - | 2778591..2778932 (-) | 342 | WP_000591749.1 | hypothetical protein | - |
| LAE57_RS13575 (LAE57_13535) | - | 2778938..2779870 (-) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| LAE57_RS13580 (LAE57_13540) | - | 2779886..2780599 (-) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| LAE57_RS13585 (LAE57_13545) | - | 2780562..2780735 (+) | 174 | WP_001801500.1 | hypothetical protein | - |
| LAE57_RS13590 (LAE57_13550) | - | 2780732..2780995 (+) | 264 | WP_000854072.1 | helix-turn-helix transcriptional regulator | - |
| LAE57_RS13595 (LAE57_13555) | - | 2781011..2781226 (+) | 216 | WP_001025404.1 | MW1434 family type I TA system toxin | - |
| LAE57_RS13600 (LAE57_13560) | - | 2781215..2781544 (-) | 330 | WP_000180411.1 | hypothetical protein | - |
| LAE57_RS13605 (LAE57_13565) | - | 2781595..2782347 (+) | 753 | WP_168367465.1 | phage antirepressor KilAC domain-containing protein | - |
| LAE57_RS13610 (LAE57_13570) | - | 2782363..2782560 (+) | 198 | WP_001148861.1 | hypothetical protein | - |
| LAE57_RS13615 (LAE57_13575) | - | 2782591..2782731 (+) | 141 | WP_000939496.1 | hypothetical protein | - |
| LAE57_RS13620 (LAE57_13580) | - | 2782746..2783378 (-) | 633 | WP_000275058.1 | hypothetical protein | - |
| LAE57_RS13625 (LAE57_13585) | - | 2783437..2783757 (+) | 321 | WP_001120197.1 | DUF771 domain-containing protein | - |
| LAE57_RS13630 (LAE57_13590) | - | 2783754..2783915 (+) | 162 | WP_000066020.1 | DUF1270 domain-containing protein | - |
| LAE57_RS13635 (LAE57_13595) | - | 2784007..2784309 (+) | 303 | WP_044131919.1 | DUF2482 family protein | - |
| LAE57_RS13640 (LAE57_13600) | - | 2784314..2784574 (+) | 261 | WP_072456798.1 | DUF1108 family protein | - |
| LAE57_RS13645 (LAE57_13605) | - | 2784583..2784846 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| LAE57_RS13650 (LAE57_13610) | - | 2784855..2786798 (+) | 1944 | WP_044557032.1 | AAA family ATPase | - |
| LAE57_RS13655 (LAE57_13615) | - | 2786800..2787720 (+) | 921 | WP_000138475.1 | recombinase RecT | - |
| LAE57_RS13660 (LAE57_13620) | - | 2787801..2788418 (+) | 618 | WP_071621397.1 | MBL fold metallo-hydrolase | - |
| LAE57_RS13665 (LAE57_13625) | ssbA | 2788419..2788889 (+) | 471 | WP_000934772.1 | single-stranded DNA-binding protein | Machinery gene |
| LAE57_RS13670 (LAE57_13630) | - | 2788919..2789812 (+) | 894 | WP_031770227.1 | DnaD domain protein | - |
| LAE57_RS13675 (LAE57_13635) | - | 2789819..2790037 (+) | 219 | WP_000338528.1 | hypothetical protein | - |
| LAE57_RS13680 (LAE57_13640) | - | 2790046..2790501 (+) | 456 | WP_000401965.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LAE57_RS13685 (LAE57_13645) | - | 2790514..2790882 (+) | 369 | WP_000101275.1 | SA1788 family PVL leukocidin-associated protein | - |
| LAE57_RS13690 (LAE57_13650) | - | 2790886..2791128 (+) | 243 | WP_000131384.1 | SAV1978 family virulence-associated passenger protein | - |
| LAE57_RS13695 (LAE57_13655) | - | 2791142..2791390 (+) | 249 | WP_001065072.1 | DUF1024 family protein | - |
| LAE57_RS13700 (LAE57_13660) | - | 2791383..2791919 (+) | 537 | WP_001562696.1 | dUTPase | - |
| LAE57_RS13705 (LAE57_13665) | - | 2791956..2792201 (+) | 246 | WP_001282074.1 | hypothetical protein | - |
| LAE57_RS13710 (LAE57_13670) | - | 2792198..2792404 (+) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| LAE57_RS13715 (LAE57_13675) | - | 2792401..2792787 (+) | 387 | WP_224056910.1 | DUF1523 family protein | - |
| LAE57_RS13720 (LAE57_13680) | rinB | 2792784..2792933 (+) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| LAE57_RS13725 (LAE57_13685) | - | 2792933..2793133 (+) | 201 | WP_000265043.1 | DUF1514 family protein | - |
| LAE57_RS13730 (LAE57_13690) | - | 2793161..2793577 (+) | 417 | WP_000590122.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17657.52 Da Isoelectric Point: 5.2672
>NTDB_id=605750 LAE57_RS13665 WP_000934772.1 2788419..2788889(+) (ssbA) [Staphylococcus aureus strain DC.RB_015]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINVIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINVIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=605750 LAE57_RS13665 WP_000934772.1 2788419..2788889(+) (ssbA) [Staphylococcus aureus strain DC.RB_015]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATAAATGTCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATAAATGTCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Vibrio cholerae strain A1552 |
31.492 |
100 |
0.365 |