Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | LAJ50_RS07100 | Genome accession | NZ_CP083376 |
| Coordinates | 1613795..1614277 (-) | Length | 160 a.a. |
| NCBI ID | WP_138654081.1 | Uniprot ID | - |
| Organism | Pseudoxanthomonas sp. X-1 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1609253..1650227 | 1613795..1614277 | within | 0 |
Gene organization within MGE regions
Location: 1609253..1650227
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LAJ50_RS07060 (LAJ50_07055) | - | 1609253..1610203 (-) | 951 | WP_138654097.1 | integrase | - |
| LAJ50_RS07065 (LAJ50_07060) | - | 1610278..1610514 (-) | 237 | WP_138654095.1 | DUF4224 domain-containing protein | - |
| LAJ50_RS07070 (LAJ50_07065) | - | 1610511..1611098 (-) | 588 | WP_224096551.1 | DnaJ domain-containing protein | - |
| LAJ50_RS07075 (LAJ50_07070) | - | 1611088..1611405 (-) | 318 | WP_138654091.1 | hypothetical protein | - |
| LAJ50_RS07080 (LAJ50_07075) | - | 1611398..1611685 (-) | 288 | WP_138654089.1 | hypothetical protein | - |
| LAJ50_RS07085 (LAJ50_07080) | - | 1612258..1612992 (-) | 735 | WP_138654087.1 | hypothetical protein | - |
| LAJ50_RS07090 (LAJ50_07085) | - | 1612994..1613215 (-) | 222 | WP_138654085.1 | hypothetical protein | - |
| LAJ50_RS07095 (LAJ50_07090) | - | 1613212..1613793 (-) | 582 | WP_138654083.1 | NUMOD4 domain-containing protein | - |
| LAJ50_RS07100 (LAJ50_07095) | ssb | 1613795..1614277 (-) | 483 | WP_138654081.1 | single-stranded DNA-binding protein | Machinery gene |
| LAJ50_RS07105 (LAJ50_07100) | - | 1614274..1614438 (-) | 165 | WP_171044638.1 | hypothetical protein | - |
| LAJ50_RS07110 (LAJ50_07105) | - | 1614440..1615012 (-) | 573 | WP_138654079.1 | hypothetical protein | - |
| LAJ50_RS07115 (LAJ50_07110) | - | 1615014..1615913 (-) | 900 | WP_138654077.1 | ATP-binding protein | - |
| LAJ50_RS07120 (LAJ50_07115) | - | 1616691..1616852 (-) | 162 | WP_171044637.1 | hypothetical protein | - |
| LAJ50_RS07125 (LAJ50_07120) | - | 1617274..1617438 (-) | 165 | WP_224096504.1 | hypothetical protein | - |
| LAJ50_RS07130 (LAJ50_07125) | - | 1617582..1617761 (-) | 180 | WP_138654075.1 | hypothetical protein | - |
| LAJ50_RS07135 (LAJ50_07130) | - | 1617758..1618129 (-) | 372 | WP_138654073.1 | hypothetical protein | - |
| LAJ50_RS07140 (LAJ50_07135) | - | 1618257..1619279 (-) | 1023 | WP_224096505.1 | hypothetical protein | - |
| LAJ50_RS07145 (LAJ50_07140) | - | 1619914..1620402 (+) | 489 | WP_138654069.1 | hypothetical protein | - |
| LAJ50_RS07150 (LAJ50_07145) | - | 1620434..1620616 (-) | 183 | WP_138654067.1 | hypothetical protein | - |
| LAJ50_RS07155 (LAJ50_07150) | - | 1620695..1621018 (-) | 324 | WP_138654065.1 | hypothetical protein | - |
| LAJ50_RS07160 (LAJ50_07155) | - | 1621073..1621480 (-) | 408 | WP_138654063.1 | hypothetical protein | - |
| LAJ50_RS07165 (LAJ50_07160) | - | 1621962..1622192 (+) | 231 | WP_138654061.1 | Cro/CI family transcriptional regulator | - |
| LAJ50_RS07170 (LAJ50_07165) | - | 1622225..1622497 (-) | 273 | WP_138654059.1 | hypothetical protein | - |
| LAJ50_RS07175 (LAJ50_07170) | - | 1622808..1623125 (+) | 318 | WP_138654057.1 | helix-turn-helix transcriptional regulator | - |
| LAJ50_RS07180 (LAJ50_07175) | - | 1623122..1623289 (+) | 168 | WP_171044635.1 | hypothetical protein | - |
| LAJ50_RS07185 (LAJ50_07180) | - | 1623358..1623525 (+) | 168 | WP_171044634.1 | hypothetical protein | - |
| LAJ50_RS07190 (LAJ50_07185) | - | 1623522..1624394 (+) | 873 | WP_138654055.1 | hypothetical protein | - |
| LAJ50_RS07195 (LAJ50_07190) | - | 1624391..1625857 (+) | 1467 | WP_224096506.1 | replicative DNA helicase | - |
| LAJ50_RS07200 (LAJ50_07195) | - | 1625889..1626449 (+) | 561 | WP_205961544.1 | phosphohydrolase | - |
| LAJ50_RS07205 (LAJ50_07200) | - | 1626613..1627056 (+) | 444 | WP_138654051.1 | hypothetical protein | - |
| LAJ50_RS07210 (LAJ50_07205) | - | 1627053..1627376 (+) | 324 | WP_138654049.1 | DUF968 domain-containing protein | - |
| LAJ50_RS07215 (LAJ50_07210) | - | 1627513..1627716 (+) | 204 | WP_138654047.1 | hypothetical protein | - |
| LAJ50_RS07220 (LAJ50_07215) | - | 1627764..1628063 (+) | 300 | WP_224096507.1 | DUF1064 domain-containing protein | - |
| LAJ50_RS07225 (LAJ50_07220) | - | 1628145..1628687 (+) | 543 | WP_138654045.1 | hypothetical protein | - |
| LAJ50_RS07230 (LAJ50_07225) | - | 1628692..1628883 (+) | 192 | WP_138654043.1 | hypothetical protein | - |
| LAJ50_RS07235 (LAJ50_07230) | - | 1629185..1629586 (+) | 402 | WP_138654041.1 | hypothetical protein | - |
| LAJ50_RS07240 (LAJ50_07235) | - | 1629586..1630926 (+) | 1341 | WP_205961542.1 | PBSX family phage terminase large subunit | - |
| LAJ50_RS07245 (LAJ50_07240) | - | 1630957..1633221 (+) | 2265 | WP_138654039.1 | hypothetical protein | - |
| LAJ50_RS07250 (LAJ50_07245) | - | 1633234..1634325 (+) | 1092 | WP_138654037.1 | hypothetical protein | - |
| LAJ50_RS07255 (LAJ50_07250) | - | 1634525..1635583 (+) | 1059 | WP_138654035.1 | phage major capsid protein | - |
| LAJ50_RS07260 (LAJ50_07255) | - | 1635637..1635891 (+) | 255 | WP_138654033.1 | hypothetical protein | - |
| LAJ50_RS07265 (LAJ50_07260) | - | 1635937..1636308 (+) | 372 | WP_138654031.1 | hypothetical protein | - |
| LAJ50_RS07270 (LAJ50_07265) | - | 1636379..1637107 (+) | 729 | WP_138654029.1 | hypothetical protein | - |
| LAJ50_RS07275 (LAJ50_07270) | - | 1637104..1638306 (+) | 1203 | WP_205961541.1 | hypothetical protein | - |
| LAJ50_RS07280 (LAJ50_07275) | - | 1638303..1640123 (+) | 1821 | WP_138654027.1 | hypothetical protein | - |
| LAJ50_RS07285 (LAJ50_07280) | - | 1640123..1640593 (+) | 471 | WP_138654025.1 | hypothetical protein | - |
| LAJ50_RS07290 (LAJ50_07285) | - | 1640590..1641207 (+) | 618 | WP_138654023.1 | hypothetical protein | - |
| LAJ50_RS07295 (LAJ50_07290) | - | 1641204..1641653 (+) | 450 | WP_138654021.1 | GNAT family N-acetyltransferase | - |
| LAJ50_RS07300 (LAJ50_07295) | - | 1641653..1642348 (+) | 696 | WP_138654019.1 | hypothetical protein | - |
| LAJ50_RS07305 (LAJ50_07300) | - | 1642351..1643517 (+) | 1167 | WP_138654017.1 | hypothetical protein | - |
| LAJ50_RS07310 (LAJ50_07305) | - | 1643514..1646126 (+) | 2613 | WP_138654015.1 | hypothetical protein | - |
| LAJ50_RS07315 (LAJ50_07310) | - | 1646067..1646267 (-) | 201 | WP_138654013.1 | hypothetical protein | - |
| LAJ50_RS07320 (LAJ50_07315) | - | 1646329..1646874 (+) | 546 | WP_138654011.1 | hypothetical protein | - |
| LAJ50_RS07325 (LAJ50_07320) | - | 1646876..1647184 (+) | 309 | WP_138654009.1 | hypothetical protein | - |
| LAJ50_RS07330 (LAJ50_07325) | - | 1647181..1647402 (+) | 222 | WP_138654007.1 | hypothetical protein | - |
| LAJ50_RS07335 (LAJ50_07330) | - | 1647399..1647920 (+) | 522 | WP_138654005.1 | endopeptidase | - |
| LAJ50_RS07340 (LAJ50_07335) | - | 1647917..1648153 (+) | 237 | WP_138654003.1 | hypothetical protein | - |
| LAJ50_RS07345 (LAJ50_07340) | - | 1648218..1650227 (+) | 2010 | WP_138654001.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 160 a.a. Molecular weight: 17949.80 Da Isoelectric Point: 6.9854
>NTDB_id=605445 LAJ50_RS07100 WP_138654081.1 1613795..1614277(-) (ssb) [Pseudoxanthomonas sp. X-1]
MSRGINKVILVGNLGNDPDTKYTQSGMAVTRISLATTSVRKDKEGDQQERTEWHRVVFFGKLGEIAGEYLRKGSQVYVEG
ELRYDKYTGQDGVEKYTTDIVCNEMQMLGGRGDGQQQGRSSSTGSRGGAPQRERPQRATDQPRDYFTDDDIPFLTNRGSW
MSRGINKVILVGNLGNDPDTKYTQSGMAVTRISLATTSVRKDKEGDQQERTEWHRVVFFGKLGEIAGEYLRKGSQVYVEG
ELRYDKYTGQDGVEKYTTDIVCNEMQMLGGRGDGQQQGRSSSTGSRGGAPQRERPQRATDQPRDYFTDDDIPFLTNRGSW
Nucleotide
Download Length: 483 bp
>NTDB_id=605445 LAJ50_RS07100 WP_138654081.1 1613795..1614277(-) (ssb) [Pseudoxanthomonas sp. X-1]
ATGAGCCGAGGTATCAACAAGGTCATCCTGGTGGGCAACCTGGGCAATGACCCGGACACTAAGTACACGCAAAGCGGCAT
GGCCGTCACCCGGATCAGCCTGGCGACCACCAGCGTCCGCAAGGACAAAGAAGGAGACCAGCAGGAGCGGACCGAATGGC
ACCGTGTGGTGTTCTTCGGGAAGCTCGGTGAGATCGCCGGTGAATACCTGCGCAAGGGTTCGCAGGTCTACGTCGAGGGC
GAGCTGCGCTACGACAAGTACACCGGCCAGGACGGCGTGGAGAAGTACACCACCGACATCGTGTGCAACGAGATGCAGAT
GCTCGGCGGACGTGGCGACGGCCAGCAGCAAGGCCGCTCCAGCTCCACCGGCAGCCGAGGCGGCGCTCCGCAGCGTGAGA
GGCCGCAGCGGGCGACCGATCAGCCGCGTGATTACTTCACCGACGACGACATTCCCTTCCTAACCAACCGCGGGAGCTGG
TGA
ATGAGCCGAGGTATCAACAAGGTCATCCTGGTGGGCAACCTGGGCAATGACCCGGACACTAAGTACACGCAAAGCGGCAT
GGCCGTCACCCGGATCAGCCTGGCGACCACCAGCGTCCGCAAGGACAAAGAAGGAGACCAGCAGGAGCGGACCGAATGGC
ACCGTGTGGTGTTCTTCGGGAAGCTCGGTGAGATCGCCGGTGAATACCTGCGCAAGGGTTCGCAGGTCTACGTCGAGGGC
GAGCTGCGCTACGACAAGTACACCGGCCAGGACGGCGTGGAGAAGTACACCACCGACATCGTGTGCAACGAGATGCAGAT
GCTCGGCGGACGTGGCGACGGCCAGCAGCAAGGCCGCTCCAGCTCCACCGGCAGCCGAGGCGGCGCTCCGCAGCGTGAGA
GGCCGCAGCGGGCGACCGATCAGCCGCGTGATTACTTCACCGACGACGACATTCCCTTCCTAACCAACCGCGGGAGCTGG
TGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
44.382 |
100 |
0.494 |
| ssb | Glaesserella parasuis strain SC1401 |
41.899 |
100 |
0.469 |
| ssb | Neisseria gonorrhoeae MS11 |
42.442 |
100 |
0.456 |
| ssb | Neisseria meningitidis MC58 |
41.86 |
100 |
0.45 |