Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | K8P63_RS19055 | Genome accession | NZ_CP082839 |
| Coordinates | 4012483..4012950 (-) | Length | 155 a.a. |
| NCBI ID | WP_223797553.1 | Uniprot ID | - |
| Organism | Sphingomonas nostoxanthinifaciens strain AK-PDB1-5 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 3979360..4024817 | 4012483..4012950 | within | 0 |
Gene organization within MGE regions
Location: 3979360..4024817
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| K8P63_RS18880 (K8P63_18775) | lptE | 3979360..3979869 (+) | 510 | WP_223797521.1 | LPS assembly lipoprotein LptE | - |
| K8P63_RS18885 (K8P63_18780) | holA | 3979866..3980891 (+) | 1026 | WP_223797522.1 | DNA polymerase III subunit delta | - |
| K8P63_RS18890 (K8P63_18785) | - | 3980888..3981346 (-) | 459 | WP_223797523.1 | transcriptional regulator | - |
| K8P63_RS18895 (K8P63_18790) | - | 3982365..3982766 (+) | 402 | WP_223797524.1 | hypothetical protein | - |
| K8P63_RS18900 (K8P63_18795) | - | 3983382..3983612 (-) | 231 | WP_223797525.1 | hypothetical protein | - |
| K8P63_RS18905 (K8P63_18800) | - | 3983644..3984015 (-) | 372 | WP_223797526.1 | hypothetical protein | - |
| K8P63_RS18910 (K8P63_18805) | - | 3984035..3984418 (-) | 384 | WP_223797527.1 | hypothetical protein | - |
| K8P63_RS18915 (K8P63_18810) | - | 3984429..3984941 (-) | 513 | WP_223797528.1 | TIGR02594 family protein | - |
| K8P63_RS18920 (K8P63_18815) | - | 3985269..3985769 (-) | 501 | WP_223797529.1 | hypothetical protein | - |
| K8P63_RS18925 (K8P63_18820) | - | 3985766..3986158 (-) | 393 | WP_223797530.1 | hypothetical protein | - |
| K8P63_RS18930 (K8P63_18825) | - | 3986441..3988075 (-) | 1635 | WP_223797531.1 | GDSL-type esterase/lipase family protein | - |
| K8P63_RS18935 (K8P63_18830) | - | 3988121..3988390 (-) | 270 | WP_223797532.1 | hypothetical protein | - |
| K8P63_RS18940 (K8P63_18835) | - | 3988406..3988978 (-) | 573 | WP_223797533.1 | hypothetical protein | - |
| K8P63_RS18945 (K8P63_18840) | - | 3988975..3989301 (-) | 327 | WP_223797534.1 | hypothetical protein | - |
| K8P63_RS18950 (K8P63_18845) | - | 3989429..3992134 (-) | 2706 | WP_223797535.1 | hypothetical protein | - |
| K8P63_RS18955 (K8P63_18850) | - | 3992134..3992937 (-) | 804 | WP_223797536.1 | hypothetical protein | - |
| K8P63_RS18960 (K8P63_18855) | - | 3992941..3993303 (-) | 363 | WP_223797537.1 | hypothetical protein | - |
| K8P63_RS18965 (K8P63_18860) | - | 3993303..3996740 (-) | 3438 | WP_223797538.1 | hypothetical protein | - |
| K8P63_RS18970 (K8P63_18865) | - | 3996993..3997316 (-) | 324 | WP_223797539.1 | hypothetical protein | - |
| K8P63_RS18975 (K8P63_18870) | - | 3997380..3998060 (-) | 681 | WP_223797540.1 | DUF6441 family protein | - |
| K8P63_RS18980 (K8P63_18875) | - | 3998193..3998909 (-) | 717 | WP_223797541.1 | hypothetical protein | - |
| K8P63_RS18985 (K8P63_18880) | - | 3998917..4000152 (-) | 1236 | WP_223797542.1 | hypothetical protein | - |
| K8P63_RS18990 (K8P63_18885) | - | 4000162..4000593 (-) | 432 | WP_223797543.1 | hypothetical protein | - |
| K8P63_RS18995 (K8P63_18890) | - | 4000593..4000901 (-) | 309 | WP_223797544.1 | hypothetical protein | - |
| K8P63_RS19000 (K8P63_18895) | - | 4000898..4001101 (-) | 204 | WP_223797545.1 | hypothetical protein | - |
| K8P63_RS19005 (K8P63_18900) | - | 4001168..4001491 (-) | 324 | WP_223797546.1 | DUF2190 family protein | - |
| K8P63_RS19010 (K8P63_18905) | - | 4001519..4001803 (-) | 285 | WP_223797547.1 | hypothetical protein | - |
| K8P63_RS19015 (K8P63_18910) | - | 4001863..4004058 (-) | 2196 | WP_223797548.1 | prohead protease/major capsid protein fusion protein | - |
| K8P63_RS19020 (K8P63_18915) | - | 4004067..4005542 (-) | 1476 | WP_223797377.1 | phage portal protein | - |
| K8P63_RS19025 (K8P63_18920) | - | 4005539..4005751 (-) | 213 | WP_223797378.1 | phage head-tail joining protein | - |
| K8P63_RS19030 (K8P63_18925) | - | 4005751..4007799 (-) | 2049 | WP_223797549.1 | terminase gpA endonuclease subunit | - |
| K8P63_RS19035 (K8P63_18930) | - | 4007747..4008346 (-) | 600 | WP_223797550.1 | hypothetical protein | - |
| K8P63_RS19040 (K8P63_18935) | - | 4008503..4008649 (-) | 147 | WP_223797381.1 | hypothetical protein | - |
| K8P63_RS19045 (K8P63_18940) | - | 4008884..4009414 (-) | 531 | WP_223797551.1 | hypothetical protein | - |
| K8P63_RS19050 (K8P63_18945) | - | 4009593..4012433 (-) | 2841 | WP_223797552.1 | phage/plasmid primase, P4 family | - |
| K8P63_RS19055 (K8P63_18950) | ssb | 4012483..4012950 (-) | 468 | WP_223797553.1 | single-stranded DNA-binding protein | Machinery gene |
| K8P63_RS19060 (K8P63_18955) | - | 4012947..4013606 (-) | 660 | WP_223797554.1 | hypothetical protein | - |
| K8P63_RS19065 (K8P63_18960) | - | 4013603..4014193 (-) | 591 | WP_223797555.1 | hypothetical protein | - |
| K8P63_RS19070 (K8P63_18965) | - | 4014217..4015080 (-) | 864 | WP_223797556.1 | DNA adenine methylase | - |
| K8P63_RS19075 (K8P63_18970) | - | 4015074..4015673 (-) | 600 | WP_223797557.1 | hypothetical protein | - |
| K8P63_RS19080 (K8P63_18975) | - | 4015670..4016020 (-) | 351 | WP_223797388.1 | hypothetical protein | - |
| K8P63_RS19085 (K8P63_18980) | - | 4016020..4016577 (-) | 558 | WP_223797558.1 | hypothetical protein | - |
| K8P63_RS19090 (K8P63_18985) | - | 4016574..4016951 (-) | 378 | WP_223797559.1 | hypothetical protein | - |
| K8P63_RS19095 (K8P63_18990) | - | 4017121..4017390 (-) | 270 | WP_223797560.1 | hypothetical protein | - |
| K8P63_RS19100 (K8P63_18995) | - | 4017496..4018200 (+) | 705 | WP_223797561.1 | S24 family peptidase | - |
| K8P63_RS19105 (K8P63_19000) | - | 4018280..4018615 (+) | 336 | WP_223797562.1 | hypothetical protein | - |
| K8P63_RS19110 (K8P63_19005) | - | 4018615..4018773 (+) | 159 | WP_223797563.1 | hypothetical protein | - |
| K8P63_RS19115 (K8P63_19010) | - | 4018812..4019426 (+) | 615 | WP_223797564.1 | hypothetical protein | - |
| K8P63_RS19120 (K8P63_19015) | - | 4019430..4019996 (+) | 567 | WP_223797565.1 | hypothetical protein | - |
| K8P63_RS19125 (K8P63_19020) | - | 4019996..4020361 (+) | 366 | WP_223797566.1 | hypothetical protein | - |
| K8P63_RS19130 (K8P63_19025) | - | 4020358..4020564 (+) | 207 | WP_223797567.1 | hypothetical protein | - |
| K8P63_RS19135 (K8P63_19030) | - | 4020561..4021685 (+) | 1125 | WP_223797568.1 | tyrosine-type recombinase/integrase | - |
| K8P63_RS19140 (K8P63_19035) | - | 4021704..4022651 (-) | 948 | WP_223797569.1 | DNA cytosine methyltransferase | - |
| K8P63_RS19145 (K8P63_19040) | - | 4022702..4023655 (-) | 954 | WP_223797570.1 | hypothetical protein | - |
| K8P63_RS19150 (K8P63_19045) | - | 4023648..4024817 (-) | 1170 | WP_223797571.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 155 a.a. Molecular weight: 17014.63 Da Isoelectric Point: 5.7977
>NTDB_id=602855 K8P63_RS19055 WP_223797553.1 4012483..4012950(-) (ssb) [Sphingomonas nostoxanthinifaciens strain AK-PDB1-5]
MSGSVNKVIIVGNLGRDPESRSFQNGGKVVNLRVATSETWKDRGSGERREKVEWHQVAIFNEGLGDVAARYLRKGSKVYI
EGQLQTRKWQDQSGADRYTTEIVVQGYHAQLVMLDGANGGGDRGGDDRRRSDQGQPPAGGQTSSFDSDLDDDVPF
MSGSVNKVIIVGNLGRDPESRSFQNGGKVVNLRVATSETWKDRGSGERREKVEWHQVAIFNEGLGDVAARYLRKGSKVYI
EGQLQTRKWQDQSGADRYTTEIVVQGYHAQLVMLDGANGGGDRGGDDRRRSDQGQPPAGGQTSSFDSDLDDDVPF
Nucleotide
Download Length: 468 bp
>NTDB_id=602855 K8P63_RS19055 WP_223797553.1 4012483..4012950(-) (ssb) [Sphingomonas nostoxanthinifaciens strain AK-PDB1-5]
ATGAGCGGTAGCGTCAACAAGGTCATCATCGTCGGCAACCTCGGCCGAGATCCGGAGAGCCGGTCGTTTCAGAACGGCGG
CAAGGTCGTGAATCTGCGCGTCGCCACGTCCGAGACGTGGAAGGATCGTGGTTCCGGCGAGCGCCGCGAAAAGGTCGAGT
GGCACCAGGTCGCCATCTTCAACGAAGGCCTCGGCGACGTCGCGGCGCGCTACCTGCGGAAGGGTAGCAAGGTCTATATC
GAGGGCCAGCTGCAGACCCGCAAATGGCAGGATCAGAGCGGCGCCGACCGCTATACGACCGAGATCGTCGTGCAGGGCTA
TCACGCGCAGCTCGTCATGCTCGATGGCGCCAACGGTGGTGGCGATCGGGGCGGTGACGATCGTCGCCGATCCGATCAGG
GCCAGCCGCCGGCCGGCGGCCAGACGAGCAGCTTCGACAGCGACTTGGATGATGACGTGCCCTTCTGA
ATGAGCGGTAGCGTCAACAAGGTCATCATCGTCGGCAACCTCGGCCGAGATCCGGAGAGCCGGTCGTTTCAGAACGGCGG
CAAGGTCGTGAATCTGCGCGTCGCCACGTCCGAGACGTGGAAGGATCGTGGTTCCGGCGAGCGCCGCGAAAAGGTCGAGT
GGCACCAGGTCGCCATCTTCAACGAAGGCCTCGGCGACGTCGCGGCGCGCTACCTGCGGAAGGGTAGCAAGGTCTATATC
GAGGGCCAGCTGCAGACCCGCAAATGGCAGGATCAGAGCGGCGCCGACCGCTATACGACCGAGATCGTCGTGCAGGGCTA
TCACGCGCAGCTCGTCATGCTCGATGGCGCCAACGGTGGTGGCGATCGGGGCGGTGACGATCGTCGCCGATCCGATCAGG
GCCAGCCGCCGGCCGGCGGCCAGACGAGCAGCTTCGACAGCGACTTGGATGATGACGTGCCCTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
48.555 |
100 |
0.542 |
| ssb | Glaesserella parasuis strain SC1401 |
60.317 |
81.29 |
0.49 |
| ssb | Neisseria meningitidis MC58 |
37.43 |
100 |
0.432 |
| ssb | Neisseria gonorrhoeae MS11 |
37.43 |
100 |
0.432 |