Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | K7H99_RS02675 | Genome accession | NZ_CP082351 |
| Coordinates | 604440..604961 (+) | Length | 173 a.a. |
| NCBI ID | WP_109912589.1 | Uniprot ID | - |
| Organism | Providencia rettgeri strain VCSW10 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 550741..620749 | 604440..604961 | within | 0 |
Gene organization within MGE regions
Location: 550741..620749
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| K7H99_RS02330 (K7H99_02330) | - | 550741..551214 (+) | 474 | WP_004914988.1 | DUF6882 domain-containing protein | - |
| K7H99_RS02335 (K7H99_02335) | - | 551577..551786 (+) | 210 | WP_109912594.1 | YdgH/BhsA/McbA-like domain containing protein | - |
| K7H99_RS02340 (K7H99_02340) | ycaC | 551924..552550 (+) | 627 | WP_004914979.1 | isochorismate family cysteine hydrolase YcaC | - |
| K7H99_RS02345 (K7H99_02345) | - | 553031..553501 (-) | 471 | WP_210786471.1 | oxidoreductase | - |
| K7H99_RS02350 (K7H99_02350) | - | 553501..554208 (-) | 708 | WP_210786473.1 | DUF3800 domain-containing protein | - |
| K7H99_RS02355 (K7H99_02355) | - | 554306..554557 (-) | 252 | WP_222960211.1 | pyocin activator PrtN family protein | - |
| K7H99_RS02360 (K7H99_02360) | - | 554660..555499 (-) | 840 | WP_262417014.1 | DNA cytosine methyltransferase | - |
| K7H99_RS02365 (K7H99_02365) | - | 555752..556267 (-) | 516 | Protein_464 | hypothetical protein | - |
| K7H99_RS02370 (K7H99_02370) | - | 556319..557146 (-) | 828 | WP_222960224.1 | YfdQ family protein | - |
| K7H99_RS02375 (K7H99_02375) | - | 557206..557577 (-) | 372 | WP_102137758.1 | hypothetical protein | - |
| K7H99_RS02380 (K7H99_02380) | csrA | 557770..557958 (-) | 189 | WP_222960653.1 | carbon storage regulator CsrA | - |
| K7H99_RS02385 (K7H99_02385) | - | 558064..558330 (+) | 267 | WP_164528381.1 | hypothetical protein | - |
| K7H99_RS02390 (K7H99_02390) | - | 558308..558526 (-) | 219 | WP_222960226.1 | hypothetical protein | - |
| K7H99_RS02395 (K7H99_02395) | - | 558705..559205 (-) | 501 | WP_094961262.1 | helix-turn-helix domain-containing protein | - |
| K7H99_RS02400 (K7H99_02400) | - | 559346..559558 (+) | 213 | WP_094961263.1 | helix-turn-helix domain-containing protein | - |
| K7H99_RS02405 (K7H99_02405) | - | 559616..560182 (+) | 567 | WP_094961264.1 | YmfL family putative regulatory protein | - |
| K7H99_RS22505 (K7H99_02410) | - | 560188..560385 (+) | 198 | WP_222960227.1 | hypothetical protein | - |
| K7H99_RS02415 (K7H99_02415) | - | 560375..560557 (+) | 183 | WP_222960228.1 | DUF4222 domain-containing protein | - |
| K7H99_RS02420 (K7H99_02420) | - | 560572..561702 (+) | 1131 | WP_222960229.1 | replication protein 15 | - |
| K7H99_RS02425 (K7H99_02425) | - | 561702..561947 (+) | 246 | WP_262417015.1 | hypothetical protein | - |
| K7H99_RS02430 (K7H99_02430) | - | 561947..562480 (+) | 534 | WP_222960234.1 | phage N-6-adenine-methyltransferase | - |
| K7H99_RS22510 (K7H99_02435) | - | 562477..562824 (+) | 348 | WP_222960236.1 | hypothetical protein | - |
| K7H99_RS02440 (K7H99_02440) | - | 562821..563024 (+) | 204 | WP_222960237.1 | hypothetical protein | - |
| K7H99_RS02445 (K7H99_02445) | - | 563017..563397 (+) | 381 | WP_166184995.1 | hypothetical protein | - |
| K7H99_RS02450 (K7H99_02450) | - | 563406..563579 (+) | 174 | WP_262417016.1 | Lar family restriction alleviation protein | - |
| K7H99_RS02455 (K7H99_02455) | - | 563572..563958 (+) | 387 | WP_222960240.1 | RusA family crossover junction endodeoxyribonuclease | - |
| K7H99_RS22100 | - | 564156..564494 (+) | 339 | Protein_483 | DUF968 domain-containing protein | - |
| K7H99_RS02465 (K7H99_02465) | - | 564527..565198 (+) | 672 | WP_211889051.1 | bacteriophage antitermination protein Q | - |
| K7H99_RS02470 (K7H99_02470) | - | 565872..566135 (-) | 264 | WP_222960250.1 | hypothetical protein | - |
| K7H99_RS02475 (K7H99_02475) | - | 566419..566865 (+) | 447 | WP_222960252.1 | DUF1327 domain-containing protein | - |
| K7H99_RS02480 (K7H99_02480) | - | 566854..567075 (-) | 222 | WP_222960254.1 | hypothetical protein | - |
| K7H99_RS02485 (K7H99_02485) | - | 567231..567476 (+) | 246 | WP_222960256.1 | hypothetical protein | - |
| K7H99_RS02490 (K7H99_02490) | - | 567783..568007 (+) | 225 | WP_004911666.1 | class II holin family protein | - |
| K7H99_RS02495 (K7H99_02495) | - | 567988..568554 (+) | 567 | WP_222960258.1 | lysozyme | - |
| K7H99_RS02500 (K7H99_02500) | - | 568613..569116 (+) | 504 | WP_222960259.1 | hypothetical protein | - |
| K7H99_RS02505 (K7H99_02505) | - | 569135..569359 (+) | 225 | WP_222960260.1 | hypothetical protein | - |
| K7H99_RS02510 (K7H99_02510) | - | 569396..569620 (-) | 225 | WP_222960261.1 | HEAT repeat domain-containing protein | - |
| K7H99_RS02515 (K7H99_02515) | - | 570004..570216 (+) | 213 | WP_222960263.1 | hypothetical protein | - |
| K7H99_RS02520 (K7H99_02520) | - | 570538..571041 (+) | 504 | WP_222960264.1 | DUF1441 family protein | - |
| K7H99_RS02525 (K7H99_02525) | - | 571038..573155 (+) | 2118 | WP_222960266.1 | phage terminase large subunit family protein | - |
| K7H99_RS02530 (K7H99_02530) | - | 573152..573367 (+) | 216 | WP_102140840.1 | hypothetical protein | - |
| K7H99_RS02535 (K7H99_02535) | - | 573364..574869 (+) | 1506 | WP_222960268.1 | phage portal protein | - |
| K7H99_RS02540 (K7H99_02540) | - | 574838..576886 (+) | 2049 | WP_419181897.1 | ClpP-like prohead protease/major capsid protein fusion protein | - |
| K7H99_RS02545 (K7H99_02545) | - | 576969..577316 (+) | 348 | WP_222960269.1 | DUF2190 family protein | - |
| K7H99_RS02550 (K7H99_02550) | - | 577320..577616 (+) | 297 | WP_222960271.1 | ATP-binding protein | - |
| K7H99_RS02555 (K7H99_02555) | - | 577594..578157 (+) | 564 | WP_222960273.1 | phage tail protein | - |
| K7H99_RS02560 (K7H99_02560) | gpU | 578157..578555 (+) | 399 | WP_222960275.1 | phage minor tail U family protein | - |
| K7H99_RS02565 (K7H99_02565) | - | 578567..579058 (+) | 492 | Protein_504 | phage tail tube protein | - |
| K7H99_RS02575 (K7H99_02575) | - | 579283..579845 (+) | 563 | Protein_505 | Rha family transcriptional regulator | - |
| K7H99_RS02580 (K7H99_02580) | gpG | 579940..580317 (+) | 378 | WP_222960280.1 | phage tail assembly chaperone G | - |
| K7H99_RS02585 (K7H99_02585) | - | 580383..580655 (+) | 273 | WP_232062808.1 | phage tail assembly protein T | - |
| K7H99_RS02590 (K7H99_02590) | - | 580630..583620 (+) | 2991 | WP_222960282.1 | phage tail tape measure protein | - |
| K7H99_RS02595 (K7H99_02595) | - | 583669..583998 (+) | 330 | WP_094963150.1 | phage tail protein | - |
| K7H99_RS02600 (K7H99_02600) | - | 584067..584645 (+) | 579 | WP_222960284.1 | zinc ribbon domain-containing protein | - |
| K7H99_RS02605 (K7H99_02605) | - | 584703..585401 (+) | 699 | WP_222960286.1 | phage minor tail protein L | - |
| K7H99_RS02610 (K7H99_02610) | - | 585410..586138 (+) | 729 | WP_222960290.1 | C40 family peptidase | - |
| K7H99_RS02615 (K7H99_02615) | - | 586042..586704 (+) | 663 | WP_222960291.1 | tail assembly protein | - |
| K7H99_RS22105 | gpJ | 586707..590918 (+) | 4212 | WP_262417017.1 | TipJ family phage tail tip protein | - |
| K7H99_RS22515 (K7H99_02625) | - | 590918..591277 (+) | 360 | WP_232062788.1 | hypothetical protein | - |
| K7H99_RS02630 (K7H99_02630) | - | 591274..591882 (+) | 609 | WP_109913099.1 | hypothetical protein | - |
| K7H99_RS02635 (K7H99_02635) | - | 591949..593418 (+) | 1470 | WP_222960292.1 | hypothetical protein | - |
| K7H99_RS02640 (K7H99_02640) | - | 593483..594565 (-) | 1083 | WP_222960657.1 | tyrosine-type recombinase/integrase | - |
| K7H99_RS02645 (K7H99_02645) | dusA | 594720..595703 (+) | 984 | WP_231136012.1 | tRNA dihydrouridine(20/20a) synthase DusA | - |
| K7H99_RS02650 (K7H99_02650) | - | 595759..596742 (-) | 984 | WP_110731425.1 | quinone oxidoreductase | - |
| K7H99_RS02655 (K7H99_02655) | dnaB | 596954..598366 (+) | 1413 | WP_004260904.1 | replicative DNA helicase | - |
| K7H99_RS02660 (K7H99_02660) | alr | 598658..599740 (+) | 1083 | WP_004260901.1 | alanine racemase | - |
| K7H99_RS02665 (K7H99_02665) | - | 599843..601039 (+) | 1197 | WP_109912591.1 | aromatic amino acid transaminase | - |
| K7H99_RS02670 (K7H99_02670) | uvrA | 601119..603953 (-) | 2835 | WP_109912590.1 | excinuclease ABC subunit UvrA | - |
| K7H99_RS02675 (K7H99_02675) | ssb | 604440..604961 (+) | 522 | WP_109912589.1 | single-stranded DNA-binding protein | Machinery gene |
| K7H99_RS02680 (K7H99_02680) | - | 605236..605643 (-) | 408 | WP_109912588.1 | helix-turn-helix domain-containing protein | - |
| K7H99_RS02685 (K7H99_02685) | - | 605883..607055 (-) | 1173 | WP_109912587.1 | MFS transporter | - |
| K7H99_RS02690 (K7H99_02690) | ivbL | 607389..607478 (+) | 90 | WP_109912586.1 | ilvB operon leader peptide IvbL | - |
| K7H99_RS02695 (K7H99_02695) | ilvB | 607582..609279 (+) | 1698 | WP_110731424.1 | acetolactate synthase large subunit | - |
| K7H99_RS02700 (K7H99_02700) | ilvN | 609282..609566 (+) | 285 | WP_004914949.1 | acetolactate synthase small subunit | - |
| K7H99_RS02705 (K7H99_02705) | - | 609760..610422 (+) | 663 | WP_110731423.1 | hypothetical protein | - |
| K7H99_RS02710 (K7H99_02710) | - | 610419..610976 (-) | 558 | WP_109912583.1 | helix-turn-helix domain-containing protein | - |
| K7H99_RS02715 (K7H99_02715) | - | 611188..611940 (+) | 753 | WP_004914942.1 | sulfite exporter TauE/SafE family protein | - |
| K7H99_RS02720 (K7H99_02720) | - | 612035..613318 (+) | 1284 | WP_109912624.1 | MFS transporter | - |
| K7H99_RS02725 (K7H99_02725) | - | 613366..614853 (-) | 1488 | WP_262417018.1 | hypothetical protein | - |
| K7H99_RS02730 (K7H99_02730) | - | 615692..617038 (+) | 1347 | WP_004914933.1 | NCS2 family permease | - |
| K7H99_RS02735 (K7H99_02735) | - | 617302..618951 (+) | 1650 | WP_004914931.1 | Na+/H+ antiporter | - |
| K7H99_RS02740 (K7H99_02740) | - | 619009..619908 (+) | 900 | WP_117163035.1 | carboxylate/amino acid/amine transporter | - |
| K7H99_RS02745 (K7H99_02745) | metR | 619793..620749 (-) | 957 | WP_109912580.1 | HTH-type transcriptional regulator MetR | - |
Sequence
Protein
Download Length: 173 a.a. Molecular weight: 18561.60 Da Isoelectric Point: 4.9468
>NTDB_id=601694 K7H99_RS02675 WP_109912589.1 604440..604961(+) (ssb) [Providencia rettgeri strain VCSW10]
MASRGVNKVILIGNLGQDPEIRYMPNGGAVANLTLATSESWRDKQTGEMREKTEWHRVVIFGKLAEVAGEYLKKGSQVYI
EGSLQTRKWQDQSGQDRYTTEVVVNIGGSMQMLGGRGGDAPSQGQGGQGGWGQPQQPQAAQQFSGGGAPAARPSAPAPQT
NEPPMDFDDDIPF
MASRGVNKVILIGNLGQDPEIRYMPNGGAVANLTLATSESWRDKQTGEMREKTEWHRVVIFGKLAEVAGEYLKKGSQVYI
EGSLQTRKWQDQSGQDRYTTEVVVNIGGSMQMLGGRGGDAPSQGQGGQGGWGQPQQPQAAQQFSGGGAPAARPSAPAPQT
NEPPMDFDDDIPF
Nucleotide
Download Length: 522 bp
>NTDB_id=601694 K7H99_RS02675 WP_109912589.1 604440..604961(+) (ssb) [Providencia rettgeri strain VCSW10]
ATGGCCAGCAGAGGCGTAAACAAAGTAATTCTTATCGGTAACCTAGGACAAGATCCAGAAATCCGTTATATGCCTAACGG
CGGAGCTGTGGCAAACCTGACTCTGGCAACTTCTGAAAGTTGGCGTGACAAGCAAACCGGTGAGATGCGTGAAAAAACCG
AATGGCACCGAGTCGTTATTTTCGGCAAACTTGCTGAAGTAGCAGGTGAATACCTAAAAAAAGGTTCACAAGTCTATATC
GAAGGTTCTCTGCAAACACGTAAATGGCAAGATCAAAGTGGTCAAGATCGTTATACGACAGAAGTTGTTGTGAATATCGG
TGGCTCAATGCAAATGTTAGGTGGCCGTGGTGGTGATGCACCATCACAAGGTCAAGGCGGTCAAGGTGGTTGGGGCCAAC
CACAGCAGCCTCAAGCGGCACAACAATTCAGTGGTGGTGGAGCGCCAGCCGCACGCCCATCAGCACCTGCACCACAAACC
AATGAACCACCAATGGATTTTGATGACGATATTCCGTTCTAA
ATGGCCAGCAGAGGCGTAAACAAAGTAATTCTTATCGGTAACCTAGGACAAGATCCAGAAATCCGTTATATGCCTAACGG
CGGAGCTGTGGCAAACCTGACTCTGGCAACTTCTGAAAGTTGGCGTGACAAGCAAACCGGTGAGATGCGTGAAAAAACCG
AATGGCACCGAGTCGTTATTTTCGGCAAACTTGCTGAAGTAGCAGGTGAATACCTAAAAAAAGGTTCACAAGTCTATATC
GAAGGTTCTCTGCAAACACGTAAATGGCAAGATCAAAGTGGTCAAGATCGTTATACGACAGAAGTTGTTGTGAATATCGG
TGGCTCAATGCAAATGTTAGGTGGCCGTGGTGGTGATGCACCATCACAAGGTCAAGGCGGTCAAGGTGGTTGGGGCCAAC
CACAGCAGCCTCAAGCGGCACAACAATTCAGTGGTGGTGGAGCGCCAGCCGCACGCCCATCAGCACCTGCACCACAAACC
AATGAACCACCAATGGATTTTGATGACGATATTCCGTTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
71.667 |
100 |
0.746 |
| ssb | Glaesserella parasuis strain SC1401 |
56.684 |
100 |
0.613 |
| ssb | Neisseria meningitidis MC58 |
46.927 |
100 |
0.486 |
| ssb | Neisseria gonorrhoeae MS11 |
46.591 |
100 |
0.474 |