Detailed information NTG0600454

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: BAJP3042_RS12100
• Genome accession: NZ_CP082243
• Coordinates: 2526961..2527398 (-)
• Length: 145 a.a.
• NCBI ID: WP_151280713.1
• Uniprot ID: -
• Organism: Bacillus amyloliquefaciens strain JP3042
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2521961..2532398

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
BAJP3042_RS12050 (BAJP3042_12050)	sinI	2522345..2522518 (+)	174	WP_003153105.1	anti-repressor SinI	Regulator
BAJP3042_RS12055 (BAJP3042_12055)	sinR	2522552..2522887 (+)	336	WP_003153104.1	transcriptional regulator SinR	Regulator
BAJP3042_RS12060 (BAJP3042_12060)	tasA	2522935..2523720 (-)	786	WP_007408329.1	biofilm matrix protein TasA	-
BAJP3042_RS12065 (BAJP3042_12065)	sipW	2523785..2524369 (-)	585	WP_015240205.1	signal peptidase I SipW	-
BAJP3042_RS12070 (BAJP3042_12070)	tapA	2524341..2525012 (-)	672	WP_222835167.1	amyloid fiber anchoring/assembly protein TapA	-
BAJP3042_RS12075 (BAJP3042_12075)	-	2525271..2525600 (+)	330	WP_012117979.1	DUF3889 domain-containing protein	-
BAJP3042_RS12080 (BAJP3042_12080)	-	2525640..2525819 (-)	180	WP_003153093.1	YqzE family protein	-
BAJP3042_RS12085 (BAJP3042_12085)	comGG	2525876..2526253 (-)	378	WP_015417814.1	competence type IV pilus minor pilin ComGG	Machinery gene
BAJP3042_RS12090 (BAJP3042_12090)	comGF	2526254..2526754 (-)	501	WP_261990133.1	competence type IV pilus minor pilin ComGF	-
BAJP3042_RS12095 (BAJP3042_12095)	comGE	2526663..2526977 (-)	315	WP_012117982.1	competence type IV pilus minor pilin ComGE	-
BAJP3042_RS12100 (BAJP3042_12100)	comGD	2526961..2527398 (-)	438	WP_151280713.1	competence type IV pilus minor pilin ComGD	Machinery gene
BAJP3042_RS12105 (BAJP3042_12105)	comGC	2527388..2527654 (-)	267	WP_042635730.1	competence type IV pilus major pilin ComGC	Machinery gene
BAJP3042_RS12110 (BAJP3042_12110)	comGB	2527701..2528738 (-)	1038	WP_222835169.1	competence type IV pilus assembly protein ComGB	Machinery gene
BAJP3042_RS12115 (BAJP3042_12115)	comGA	2528725..2529795 (-)	1071	WP_003153083.1	competence type IV pilus ATPase ComGA	Machinery gene
BAJP3042_RS12120 (BAJP3042_12120)	-	2529987..2530937 (-)	951	WP_007408319.1	magnesium transporter CorA family protein	-
BAJP3042_RS12125 (BAJP3042_12125)	-	2531083..2532384 (+)	1302	WP_063094766.1	hemolysin family protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16228.70 Da
• Isoelectric Point: 10.3826

>NTDB_id=600454 BAJP3042_RS12100 WP_151280713.1 2526961..2527398(-) (comGD) [Bacillus amyloliquefaciens strain JP3042]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPAYTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKAHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide

• Length: 438 bp

>NTDB_id=600454 BAJP3042_RS12100 WP_151280713.1 2526961..2527398(-) (comGD) [Bacillus amyloliquefaciens strain JP3042]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGTCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGCCTACACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGCGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCCTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	56.164	100	0.566