Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   BAJP3042_RS12050 Genome accession   NZ_CP082243
Coordinates   2522345..2522518 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus amyloliquefaciens strain JP3042     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2517345..2527518
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BAJP3042_RS12035 (BAJP3042_12035) gcvT 2518158..2519258 (-) 1101 WP_222835165.1 glycine cleavage system aminomethyltransferase GcvT -
  BAJP3042_RS12040 (BAJP3042_12040) - 2519682..2521352 (+) 1671 WP_222835166.1 DEAD/DEAH box helicase -
  BAJP3042_RS12045 (BAJP3042_12045) - 2521374..2522168 (+) 795 WP_014418368.1 YqhG family protein -
  BAJP3042_RS12050 (BAJP3042_12050) sinI 2522345..2522518 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  BAJP3042_RS12055 (BAJP3042_12055) sinR 2522552..2522887 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  BAJP3042_RS12060 (BAJP3042_12060) tasA 2522935..2523720 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  BAJP3042_RS12065 (BAJP3042_12065) sipW 2523785..2524369 (-) 585 WP_015240205.1 signal peptidase I SipW -
  BAJP3042_RS12070 (BAJP3042_12070) tapA 2524341..2525012 (-) 672 WP_222835167.1 amyloid fiber anchoring/assembly protein TapA -
  BAJP3042_RS12075 (BAJP3042_12075) - 2525271..2525600 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  BAJP3042_RS12080 (BAJP3042_12080) - 2525640..2525819 (-) 180 WP_003153093.1 YqzE family protein -
  BAJP3042_RS12085 (BAJP3042_12085) comGG 2525876..2526253 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  BAJP3042_RS12090 (BAJP3042_12090) comGF 2526254..2526754 (-) 501 WP_261990133.1 competence type IV pilus minor pilin ComGF -
  BAJP3042_RS12095 (BAJP3042_12095) comGE 2526663..2526977 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  BAJP3042_RS12100 (BAJP3042_12100) comGD 2526961..2527398 (-) 438 WP_151280713.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=600451 BAJP3042_RS12050 WP_003153105.1 2522345..2522518(+) (sinI) [Bacillus amyloliquefaciens strain JP3042]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=600451 BAJP3042_RS12050 WP_003153105.1 2522345..2522518(+) (sinI) [Bacillus amyloliquefaciens strain JP3042]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702