Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGC   Type   Machinery gene
Locus tag   BAJP3042_RS12105 Genome accession   NZ_CP082243
Coordinates   2527388..2527654 (-) Length   88 a.a.
NCBI ID   WP_042635730.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain JP3042     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2522388..2532654
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BAJP3042_RS12055 (BAJP3042_12055) sinR 2522552..2522887 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  BAJP3042_RS12060 (BAJP3042_12060) tasA 2522935..2523720 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  BAJP3042_RS12065 (BAJP3042_12065) sipW 2523785..2524369 (-) 585 WP_015240205.1 signal peptidase I SipW -
  BAJP3042_RS12070 (BAJP3042_12070) tapA 2524341..2525012 (-) 672 WP_222835167.1 amyloid fiber anchoring/assembly protein TapA -
  BAJP3042_RS12075 (BAJP3042_12075) - 2525271..2525600 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  BAJP3042_RS12080 (BAJP3042_12080) - 2525640..2525819 (-) 180 WP_003153093.1 YqzE family protein -
  BAJP3042_RS12085 (BAJP3042_12085) comGG 2525876..2526253 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  BAJP3042_RS12090 (BAJP3042_12090) comGF 2526254..2526754 (-) 501 WP_261990133.1 competence type IV pilus minor pilin ComGF -
  BAJP3042_RS12095 (BAJP3042_12095) comGE 2526663..2526977 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  BAJP3042_RS12100 (BAJP3042_12100) comGD 2526961..2527398 (-) 438 WP_151280713.1 competence type IV pilus minor pilin ComGD Machinery gene
  BAJP3042_RS12105 (BAJP3042_12105) comGC 2527388..2527654 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  BAJP3042_RS12110 (BAJP3042_12110) comGB 2527701..2528738 (-) 1038 WP_222835169.1 competence type IV pilus assembly protein ComGB Machinery gene
  BAJP3042_RS12115 (BAJP3042_12115) comGA 2528725..2529795 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  BAJP3042_RS12120 (BAJP3042_12120) - 2529987..2530937 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -
  BAJP3042_RS12125 (BAJP3042_12125) - 2531083..2532384 (+) 1302 WP_063094766.1 hemolysin family protein -

Sequence

Protein


Download         Length: 88 a.a.        Molecular weight: 9721.32 Da        Isoelectric Point: 6.2027

>NTDB_id=600455 BAJP3042_RS12105 WP_042635730.1 2527388..2527654(-) (comGC) [Bacillus amyloliquefaciens strain JP3042]
MLIVLFIVSILLLITIPNVTKHNQSIQHKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=600455 BAJP3042_RS12105 WP_042635730.1 2527388..2527654(-) (comGC) [Bacillus amyloliquefaciens strain JP3042]
ATGCTGATCGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCATAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGACCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGCCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

74.648

80.682

0.602