Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | K5O11_RS06955 | Genome accession | NZ_CP081881 |
| Coordinates | 1459394..1459900 (-) | Length | 168 a.a. |
| NCBI ID | WP_071447819.1 | Uniprot ID | - |
| Organism | Escherichia coli strain WW2 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1441169..1493363 | 1459394..1459900 | within | 0 |
Gene organization within MGE regions
Location: 1441169..1493363
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| K5O11_RS06870 (K5O11_06865) | dsdC | 1441169..1442116 (+) | 948 | WP_001361861.1 | DNA-binding transcriptional regulator DsdC | - |
| K5O11_RS06875 (K5O11_06870) | ipuB | 1442511..1443080 (-) | 570 | WP_001224627.1 | tyrosine-type DNA invertase IpuB | - |
| K5O11_RS06880 (K5O11_06875) | ipuA | 1443829..1444458 (+) | 630 | WP_001181154.1 | tyrosine-type DNA invertase IpuA | - |
| K5O11_RS06885 (K5O11_06880) | - | 1444776..1445396 (+) | 621 | WP_000243052.1 | helix-turn-helix transcriptional regulator | - |
| K5O11_RS06890 (K5O11_06885) | - | 1445421..1453340 (+) | 7920 | WP_001361862.1 | phase-variable autotransporter adhesin UpaE | - |
| K5O11_RS06895 (K5O11_06890) | - | 1453388..1453918 (+) | 531 | WP_000100042.1 | hypothetical protein | - |
| K5O11_RS06900 (K5O11_06895) | torI | 1454444..1454644 (-) | 201 | WP_001163428.1 | response regulator inhibitor TorI | - |
| K5O11_RS06905 (K5O11_06900) | - | 1454702..1454869 (-) | 168 | WP_108997186.1 | hypothetical protein | - |
| K5O11_RS06910 (K5O11_06905) | - | 1454927..1455727 (-) | 801 | WP_108997184.1 | hypothetical protein | - |
| K5O11_RS06915 (K5O11_06910) | - | 1455770..1456054 (-) | 285 | WP_124053540.1 | ASCH domain-containing protein | - |
| K5O11_RS06920 (K5O11_06915) | - | 1456047..1456817 (-) | 771 | WP_233324800.1 | hypothetical protein | - |
| K5O11_RS25185 | - | 1456818..1456943 (-) | 126 | Protein_1358 | hypothetical protein | - |
| K5O11_RS06925 (K5O11_06920) | - | 1456946..1457137 (-) | 192 | WP_108997177.1 | hypothetical protein | - |
| K5O11_RS06930 (K5O11_06925) | - | 1457139..1457630 (-) | 492 | WP_108997175.1 | XF1762 family protein | - |
| K5O11_RS25530 (K5O11_06930) | - | 1457630..1458328 (-) | 699 | WP_167823447.1 | ead/Ea22-like family protein | - |
| K5O11_RS06940 (K5O11_06935) | - | 1458325..1458912 (-) | 588 | WP_222563252.1 | hypothetical protein | - |
| K5O11_RS06945 (K5O11_06940) | - | 1458909..1459073 (-) | 165 | WP_001214456.1 | DUF2737 family protein | - |
| K5O11_RS06950 (K5O11_06945) | - | 1459084..1459380 (-) | 297 | WP_078207967.1 | phage anti-RecBCD protein | - |
| K5O11_RS06955 (K5O11_06950) | ssb | 1459394..1459900 (-) | 507 | WP_071447819.1 | single-stranded DNA-binding protein | Machinery gene |
| K5O11_RS06960 (K5O11_06955) | - | 1459901..1460608 (-) | 708 | WP_058115767.1 | Rad52/Rad22 family DNA repair protein | - |
| K5O11_RS06965 (K5O11_06960) | kil | 1460863..1461015 (-) | 153 | WP_001243355.1 | host cell division inhibitory peptide Kil | - |
| K5O11_RS06970 (K5O11_06965) | - | 1461000..1461131 (-) | 132 | WP_000638547.1 | protease FtsH-inhibitory lysogeny factor CIII | - |
| K5O11_RS06975 (K5O11_06970) | - | 1461156..1462124 (-) | 969 | WP_138217215.1 | cell envelope biogenesis protein TolA | - |
| K5O11_RS06980 (K5O11_06975) | - | 1462306..1462527 (-) | 222 | WP_233324796.1 | hypothetical protein | - |
| K5O11_RS06985 (K5O11_06980) | - | 1462647..1462952 (-) | 306 | WP_113403480.1 | regulator | - |
| K5O11_RS06990 (K5O11_06985) | - | 1463267..1463917 (-) | 651 | WP_001095982.1 | LexA family protein | - |
| K5O11_RS06995 (K5O11_06990) | - | 1463998..1464183 (+) | 186 | WP_000276885.1 | Cro/CI family transcriptional regulator | - |
| K5O11_RS07000 (K5O11_06995) | - | 1464299..1464595 (+) | 297 | WP_172479720.1 | CII family transcriptional regulator | - |
| K5O11_RS07005 (K5O11_07000) | - | 1464628..1464774 (+) | 147 | WP_016238079.1 | DUF2740 family protein | - |
| K5O11_RS07010 (K5O11_07005) | - | 1464767..1465666 (+) | 900 | WP_172479722.1 | DNA replication protein | - |
| K5O11_RS07015 (K5O11_07010) | - | 1465656..1467092 (+) | 1437 | WP_172479723.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| K5O11_RS07020 (K5O11_07015) | - | 1467169..1467609 (+) | 441 | WP_222563253.1 | recombination protein NinB | - |
| K5O11_RS07025 (K5O11_07020) | - | 1467606..1468196 (+) | 591 | WP_021560741.1 | MT-A70 family methyltransferase | - |
| K5O11_RS07030 (K5O11_07025) | ninD | 1468193..1468366 (+) | 174 | WP_000679700.1 | protein NinD | - |
| K5O11_RS07035 (K5O11_07030) | - | 1468333..1468509 (+) | 177 | WP_000113772.1 | NinE family protein | - |
| K5O11_RS07040 (K5O11_07035) | - | 1468512..1468871 (+) | 360 | WP_109555390.1 | phage protein NinX family protein | - |
| K5O11_RS07045 (K5O11_07040) | - | 1468871..1469047 (+) | 177 | WP_000950973.1 | protein NinF | - |
| K5O11_RS07050 (K5O11_07045) | - | 1469040..1469252 (+) | 213 | WP_001286917.1 | hypothetical protein | - |
| K5O11_RS07055 (K5O11_07050) | - | 1469245..1469535 (+) | 291 | WP_222563254.1 | DUF1364 domain-containing protein | - |
| K5O11_RS07060 (K5O11_07055) | - | 1469532..1469894 (+) | 363 | WP_001008180.1 | RusA family crossover junction endodeoxyribonuclease | - |
| K5O11_RS07065 (K5O11_07060) | - | 1469891..1470079 (+) | 189 | WP_000994515.1 | protein ninH | - |
| K5O11_RS07070 (K5O11_07065) | - | 1470076..1470699 (+) | 624 | WP_001235461.1 | antitermination protein | - |
| K5O11_RS07075 (K5O11_07070) | - | 1471803..1472126 (+) | 324 | WP_000783734.1 | phage holin, lambda family | - |
| K5O11_RS07080 (K5O11_07075) | - | 1472110..1472586 (+) | 477 | WP_089564108.1 | glycoside hydrolase family 104 protein | - |
| K5O11_RS07085 (K5O11_07080) | - | 1472583..1473050 (+) | 468 | WP_138217227.1 | lysis protein | - |
| K5O11_RS07090 (K5O11_07085) | - | 1473038..1473190 (+) | 153 | WP_001139681.1 | hypothetical protein | - |
| K5O11_RS07095 (K5O11_07090) | - | 1473355..1473597 (+) | 243 | WP_000807788.1 | DUF2560 family protein | - |
| K5O11_RS07100 (K5O11_07095) | - | 1473633..1474121 (+) | 489 | WP_000729920.1 | DNA-packaging protein | - |
| K5O11_RS07105 (K5O11_07100) | - | 1474099..1475598 (+) | 1500 | WP_000417851.1 | terminase large subunit domain-containing protein | - |
| K5O11_RS07110 (K5O11_07105) | - | 1475599..1477764 (+) | 2166 | WP_023486193.1 | portal protein | - |
| K5O11_RS07115 (K5O11_07110) | - | 1477778..1478689 (+) | 912 | WP_000373010.1 | scaffold protein | - |
| K5O11_RS07120 (K5O11_07115) | - | 1478689..1479984 (+) | 1296 | WP_222563255.1 | P22 phage major capsid protein family protein | - |
| K5O11_RS07125 (K5O11_07120) | - | 1480029..1480283 (+) | 255 | WP_106382293.1 | hypothetical protein | - |
| K5O11_RS07130 (K5O11_07125) | - | 1480261..1480761 (+) | 501 | WP_032153671.1 | packaged DNA stabilization gp4 family protein | - |
| K5O11_RS07135 (K5O11_07130) | - | 1480761..1482179 (+) | 1419 | WP_222563256.1 | packaged DNA stabilization protein gp10 | - |
| K5O11_RS07140 (K5O11_07135) | - | 1482179..1483132 (+) | 954 | WP_087503464.1 | tail needle knob protein | - |
| K5O11_RS07145 (K5O11_07140) | - | 1483132..1483587 (+) | 456 | WP_087503465.1 | DUF2824 family protein | - |
| K5O11_RS07150 (K5O11_07145) | - | 1483590..1484282 (+) | 693 | WP_087503466.1 | DNA transfer protein | - |
| K5O11_RS07155 (K5O11_07150) | - | 1484292..1485623 (+) | 1332 | WP_087503467.1 | phage DNA ejection protein | - |
| K5O11_RS07160 (K5O11_07155) | - | 1485624..1488017 (+) | 2394 | WP_087503468.1 | lytic transglycosylase domain-containing protein | - |
| K5O11_RS07165 (K5O11_07160) | - | 1488182..1490581 (+) | 2400 | WP_029701265.1 | phage head-binding domain-containing protein | - |
| K5O11_RS07170 (K5O11_07165) | - | 1490701..1491237 (-) | 537 | WP_060579112.1 | GDSL-type esterase/lipase family protein | - |
| K5O11_RS07175 (K5O11_07170) | - | 1491433..1492089 (+) | 657 | WP_016242483.1 | DUF1796 family putative cysteine peptidase | - |
| K5O11_RS07180 (K5O11_07175) | intS | 1492206..1493363 (-) | 1158 | WP_222563258.1 | prophage integrase IntS | - |
Sequence
Protein
Download Length: 168 a.a. Molecular weight: 18761.06 Da Isoelectric Point: 8.4877
>NTDB_id=598033 K5O11_RS06955 WP_071447819.1 1459394..1459900(-) (ssb) [Escherichia coli strain WW2]
MASRGVNKVIILGRVGQDPEVRYSPSGTAFANLTIATSEQWRDKNTGEQKELTEWHRVAVSGKLAEVVGQYVKKGDQIYF
EGMLRTRKWKDQSGQDRYTTEVHVGINGVMQMLGSIGDSKQQAASRQSQKPQQQSSPAQHNEPPMDFDDDIPFAPVTLPF
PRHAIHAI
MASRGVNKVIILGRVGQDPEVRYSPSGTAFANLTIATSEQWRDKNTGEQKELTEWHRVAVSGKLAEVVGQYVKKGDQIYF
EGMLRTRKWKDQSGQDRYTTEVHVGINGVMQMLGSIGDSKQQAASRQSQKPQQQSSPAQHNEPPMDFDDDIPFAPVTLPF
PRHAIHAI
Nucleotide
Download Length: 507 bp
>NTDB_id=598033 K5O11_RS06955 WP_071447819.1 1459394..1459900(-) (ssb) [Escherichia coli strain WW2]
ATGGCAAGCAGAGGCGTAAATAAGGTGATTATCCTTGGTCGGGTAGGACAAGACCCGGAAGTTCGATACTCACCATCAGG
AACAGCGTTCGCTAACCTGACAATAGCCACGTCAGAACAATGGCGAGATAAAAATACTGGCGAGCAAAAGGAATTGACTG
AATGGCATCGTGTTGCTGTATCCGGGAAACTGGCTGAGGTCGTGGGGCAGTATGTGAAAAAAGGTGATCAGATTTATTTC
GAGGGAATGCTGAGAACCAGAAAGTGGAAAGACCAGTCAGGGCAAGACCGTTACACAACCGAGGTTCATGTCGGAATTAA
TGGCGTGATGCAAATGCTTGGCAGCATTGGCGACAGCAAACAACAAGCAGCCAGCAGGCAATCACAGAAGCCACAGCAGC
AATCATCACCAGCACAACACAACGAACCTCCGATGGATTTTGACGACGATATACCCTTTGCACCAGTAACTCTCCCCTTC
CCTCGTCACGCTATTCACGCAATTTAA
ATGGCAAGCAGAGGCGTAAATAAGGTGATTATCCTTGGTCGGGTAGGACAAGACCCGGAAGTTCGATACTCACCATCAGG
AACAGCGTTCGCTAACCTGACAATAGCCACGTCAGAACAATGGCGAGATAAAAATACTGGCGAGCAAAAGGAATTGACTG
AATGGCATCGTGTTGCTGTATCCGGGAAACTGGCTGAGGTCGTGGGGCAGTATGTGAAAAAAGGTGATCAGATTTATTTC
GAGGGAATGCTGAGAACCAGAAAGTGGAAAGACCAGTCAGGGCAAGACCGTTACACAACCGAGGTTCATGTCGGAATTAA
TGGCGTGATGCAAATGCTTGGCAGCATTGGCGACAGCAAACAACAAGCAGCCAGCAGGCAATCACAGAAGCCACAGCAGC
AATCATCACCAGCACAACACAACGAACCTCCGATGGATTTTGACGACGATATACCCTTTGCACCAGTAACTCTCCCCTTC
CCTCGTCACGCTATTCACGCAATTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
61.798 |
100 |
0.655 |
| ssb | Glaesserella parasuis strain SC1401 |
45.856 |
100 |
0.494 |
| ssb | Neisseria meningitidis MC58 |
38.068 |
100 |
0.399 |
| ssb | Neisseria gonorrhoeae MS11 |
38.068 |
100 |
0.399 |