Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | K5E88_RS01110 | Genome accession | NZ_CP081486 |
| Coordinates | 175301..175801 (-) | Length | 166 a.a. |
| NCBI ID | WP_005719438.1 | Uniprot ID | A0A9X3URY5 |
| Organism | Pasteurella multocida strain Pm3 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 112907..179435 | 175301..175801 | within | 0 |
| IS/Tn | 174654..175118 | 175301..175801 | flank | 183 |
Gene organization within MGE regions
Location: 112907..179435
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| K5E88_RS00690 (K5E88_00690) | fis | 112907..113206 (+) | 300 | WP_005723276.1 | DNA-binding transcriptional regulator Fis | - |
| K5E88_RS00695 (K5E88_00695) | purL | 113431..117324 (+) | 3894 | WP_014325715.1 | phosphoribosylformylglycinamidine synthase | - |
| K5E88_RS00700 (K5E88_00700) | - | 117740..118312 (-) | 573 | WP_014325716.1 | hypothetical protein | - |
| K5E88_RS00705 (K5E88_00705) | - | 118326..119564 (-) | 1239 | WP_014325717.1 | DUF262 domain-containing protein | - |
| K5E88_RS00710 (K5E88_00710) | - | 120582..120776 (+) | 195 | Protein_138 | hypothetical protein | - |
| K5E88_RS00715 (K5E88_00715) | tnpA | 120853..121269 (-) | 417 | WP_005720092.1 | IS200/IS605 family transposase | - |
| K5E88_RS00720 (K5E88_00720) | - | 121316..122452 (+) | 1137 | WP_064775610.1 | RNA-guided endonuclease TnpB family protein | - |
| K5E88_RS00725 (K5E88_00725) | - | 122592..122918 (-) | 327 | WP_156707168.1 | hypothetical protein | - |
| K5E88_RS00730 (K5E88_00730) | - | 122966..128866 (-) | 5901 | WP_221812497.1 | phage tail protein | - |
| K5E88_RS00735 (K5E88_00735) | - | 128870..129460 (-) | 591 | WP_042743292.1 | tail assembly protein | - |
| K5E88_RS00740 (K5E88_00740) | - | 129403..130143 (-) | 741 | WP_064775658.1 | C40 family peptidase | - |
| K5E88_RS00745 (K5E88_00745) | - | 130146..130850 (-) | 705 | WP_064775657.1 | phage minor tail protein L | - |
| K5E88_RS11470 | - | 130847..133561 (-) | 2715 | WP_064775656.1 | tape measure protein | - |
| K5E88_RS00755 (K5E88_00755) | - | 133684..134379 (-) | 696 | WP_064775655.1 | hypothetical protein | - |
| K5E88_RS00760 (K5E88_00760) | - | 134684..135037 (-) | 354 | WP_231140379.1 | phage tail protein | - |
| K5E88_RS00765 (K5E88_00765) | - | 135383..135799 (-) | 417 | WP_016533103.1 | hypothetical protein | - |
| K5E88_RS00770 (K5E88_00770) | - | 135872..136888 (-) | 1017 | WP_016533104.1 | phage tail tube protein | - |
| K5E88_RS00775 (K5E88_00775) | - | 136901..137293 (-) | 393 | WP_015691079.1 | phage tail terminator-like protein | - |
| K5E88_RS00780 (K5E88_00780) | - | 137293..137694 (-) | 402 | WP_015691078.1 | HK97 gp10 family phage protein | - |
| K5E88_RS00785 (K5E88_00785) | - | 137696..138070 (-) | 375 | WP_015691077.1 | hypothetical protein | - |
| K5E88_RS00790 (K5E88_00790) | - | 138072..138539 (-) | 468 | WP_015691076.1 | DnaT-like ssDNA-binding protein | - |
| K5E88_RS00795 (K5E88_00795) | - | 138556..138792 (-) | 237 | WP_015691075.1 | HeH/LEM domain-containing protein | - |
| K5E88_RS00800 (K5E88_00800) | - | 138849..140006 (-) | 1158 | WP_015691074.1 | P22 phage major capsid protein family protein | - |
| K5E88_RS00805 (K5E88_00805) | - | 140024..140794 (-) | 771 | WP_015691073.1 | hypothetical protein | - |
| K5E88_RS00810 (K5E88_00810) | - | 140923..141090 (-) | 168 | WP_015691072.1 | hypothetical protein | - |
| K5E88_RS00815 (K5E88_00815) | - | 141130..141564 (-) | 435 | WP_015691071.1 | HD domain-containing protein | - |
| K5E88_RS00820 (K5E88_00820) | - | 141539..141757 (-) | 219 | WP_015691070.1 | hypothetical protein | - |
| K5E88_RS00825 (K5E88_00825) | - | 141760..143373 (-) | 1614 | WP_231140380.1 | minor capsid protein | - |
| K5E88_RS00830 (K5E88_00830) | - | 143351..144754 (-) | 1404 | WP_064775653.1 | DUF4055 domain-containing protein | - |
| K5E88_RS00835 (K5E88_00835) | - | 144764..146035 (-) | 1272 | WP_064775652.1 | terminase large subunit domain-containing protein | - |
| K5E88_RS00840 (K5E88_00840) | - | 146038..146628 (-) | 591 | WP_081273988.1 | HGGxSTG domain-containing protein | - |
| K5E88_RS00845 (K5E88_00845) | - | 146944..147372 (-) | 429 | WP_016533416.1 | hypothetical protein | - |
| K5E88_RS00850 (K5E88_00850) | - | 147359..148060 (-) | 702 | WP_064775651.1 | hypothetical protein | - |
| K5E88_RS00855 (K5E88_00855) | - | 148199..148579 (+) | 381 | WP_064775650.1 | hypothetical protein | - |
| K5E88_RS00860 (K5E88_00860) | - | 148567..148821 (+) | 255 | WP_064775649.1 | HTH domain-containing protein | - |
| K5E88_RS00865 (K5E88_00865) | - | 148951..149307 (-) | 357 | WP_064775648.1 | hypothetical protein | - |
| K5E88_RS00870 (K5E88_00870) | - | 149586..149909 (-) | 324 | WP_016569983.1 | DUF2570 family protein | - |
| K5E88_RS00875 (K5E88_00875) | - | 149912..150496 (-) | 585 | WP_016533462.1 | glycoside hydrolase family 19 protein | - |
| K5E88_RS00880 (K5E88_00880) | - | 150468..150833 (-) | 366 | WP_016533461.1 | phage holin, lambda family | - |
| K5E88_RS00885 (K5E88_00885) | - | 151047..151232 (-) | 186 | WP_143930513.1 | hypothetical protein | - |
| K5E88_RS00890 (K5E88_00890) | - | 151422..151787 (-) | 366 | WP_016533470.1 | antiterminator Q family protein | - |
| K5E88_RS00895 (K5E88_00895) | - | 151787..152389 (-) | 603 | WP_221812494.1 | recombination protein NinG | - |
| K5E88_RS00900 (K5E88_00900) | - | 152382..152519 (-) | 138 | WP_221812493.1 | hypothetical protein | - |
| K5E88_RS00905 (K5E88_00905) | - | 152512..152727 (-) | 216 | WP_170353051.1 | hypothetical protein | - |
| K5E88_RS00910 (K5E88_00910) | - | 152801..153259 (-) | 459 | WP_156734824.1 | recombination protein NinB | - |
| K5E88_RS00915 (K5E88_00915) | - | 153249..153785 (-) | 537 | WP_197418035.1 | phage N-6-adenine-methyltransferase | - |
| K5E88_RS00920 (K5E88_00920) | - | 153789..154478 (-) | 690 | WP_064964930.1 | replication protein P | - |
| K5E88_RS00925 (K5E88_00925) | - | 154478..155380 (-) | 903 | WP_016533442.1 | hypothetical protein | - |
| K5E88_RS00930 (K5E88_00930) | - | 155382..155735 (-) | 354 | WP_014390722.1 | HNH endonuclease | - |
| K5E88_RS00935 (K5E88_00935) | - | 155732..156433 (-) | 702 | WP_064775604.1 | phage antirepressor KilAC domain-containing protein | - |
| K5E88_RS00940 (K5E88_00940) | - | 156491..156766 (-) | 276 | WP_005756640.1 | hypothetical protein | - |
| K5E88_RS00945 (K5E88_00945) | - | 156787..156996 (-) | 210 | WP_005720263.1 | helix-turn-helix transcriptional regulator | - |
| K5E88_RS00950 (K5E88_00950) | - | 157124..157813 (+) | 690 | WP_064775603.1 | helix-turn-helix transcriptional regulator | - |
| K5E88_RS00955 (K5E88_00955) | - | 157959..158222 (+) | 264 | WP_016533478.1 | type II toxin-antitoxin system HicA family toxin | - |
| K5E88_RS00960 (K5E88_00960) | - | 158225..158704 (+) | 480 | WP_016533477.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| K5E88_RS00965 (K5E88_00965) | - | 158701..159084 (+) | 384 | WP_016533476.1 | hypothetical protein | - |
| K5E88_RS00970 (K5E88_00970) | - | 159703..159933 (+) | 231 | WP_016533507.1 | hypothetical protein | - |
| K5E88_RS11475 | - | 160258..160386 (+) | 129 | WP_023430120.1 | KilA-N domain-containing protein | - |
| K5E88_RS00980 (K5E88_00980) | - | 160525..161070 (+) | 546 | WP_016533491.1 | hypothetical protein | - |
| K5E88_RS00985 (K5E88_00985) | - | 161336..161983 (+) | 648 | WP_016570070.1 | Bro-N domain-containing protein | - |
| K5E88_RS00990 (K5E88_00990) | - | 162045..162275 (-) | 231 | WP_223251317.1 | hypothetical protein | - |
| K5E88_RS00995 (K5E88_00995) | - | 162423..162707 (+) | 285 | WP_064775602.1 | hypothetical protein | - |
| K5E88_RS01000 (K5E88_01000) | - | 162694..162930 (+) | 237 | WP_016570068.1 | hypothetical protein | - |
| K5E88_RS01005 (K5E88_01005) | - | 162944..163105 (+) | 162 | WP_014390707.1 | hypothetical protein | - |
| K5E88_RS01010 (K5E88_01010) | - | 163108..164094 (+) | 987 | WP_016570067.1 | hypothetical protein | - |
| K5E88_RS01015 (K5E88_01015) | bet | 164098..164949 (+) | 852 | WP_016533454.1 | phage recombination protein Bet | - |
| K5E88_RS01020 (K5E88_01020) | - | 164942..165553 (+) | 612 | WP_064775601.1 | YqaJ viral recombinase family protein | - |
| K5E88_RS01025 (K5E88_01025) | ssb | 165557..166021 (+) | 465 | WP_016570065.1 | single-stranded DNA-binding protein | Machinery gene |
| K5E88_RS01030 (K5E88_01030) | - | 166033..166224 (+) | 192 | WP_016533530.1 | hypothetical protein | - |
| K5E88_RS01035 (K5E88_01035) | - | 166267..166620 (+) | 354 | WP_016570064.1 | hypothetical protein | - |
| K5E88_RS01040 (K5E88_01040) | - | 166692..167480 (+) | 789 | WP_014391448.1 | DUF2303 family protein | - |
| K5E88_RS01045 (K5E88_01045) | - | 167531..168130 (+) | 600 | WP_064775647.1 | hypothetical protein | - |
| K5E88_RS01050 (K5E88_01050) | - | 168127..168492 (+) | 366 | WP_016533502.1 | hypothetical protein | - |
| K5E88_RS11560 (K5E88_01055) | - | 168525..168692 (+) | 168 | WP_391527361.1 | hypothetical protein | - |
| K5E88_RS01060 (K5E88_01060) | - | 168704..169192 (+) | 489 | WP_064775646.1 | DUF551 domain-containing protein | - |
| K5E88_RS01065 (K5E88_01065) | - | 169296..170204 (+) | 909 | WP_015691048.1 | P63C domain-containing protein | - |
| K5E88_RS01070 (K5E88_01070) | - | 170449..170670 (+) | 222 | WP_064775645.1 | hypothetical protein | - |
| K5E88_RS01075 (K5E88_01075) | - | 170681..171403 (+) | 723 | WP_014391442.1 | phage antirepressor KilAC domain-containing protein | - |
| K5E88_RS01080 (K5E88_01080) | - | 171587..171889 (+) | 303 | WP_075271365.1 | helix-turn-helix domain-containing protein | - |
| K5E88_RS01085 (K5E88_01085) | - | 171793..172848 (+) | 1056 | WP_014391441.1 | site-specific integrase | - |
| K5E88_RS01100 (K5E88_01100) | folD | 173223..174077 (+) | 855 | WP_005725034.1 | bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD | - |
| K5E88_RS01105 (K5E88_01105) | tnpA | 174654..175118 (-) | 465 | WP_014325726.1 | IS200/IS605 family transposase | - |
| K5E88_RS01110 (K5E88_01110) | ssb | 175301..175801 (-) | 501 | WP_005719438.1 | single-stranded DNA-binding protein | Machinery gene |
| K5E88_RS01115 (K5E88_01115) | uvrA | 175973..178804 (+) | 2832 | WP_014326374.1 | excinuclease ABC subunit UvrA | - |
| K5E88_RS01120 (K5E88_01120) | sodC | 178875..179435 (+) | 561 | Protein_218 | superoxide dismutase [Cu-Zn] SodC | - |
Sequence
Protein
Download Length: 166 a.a. Molecular weight: 18673.68 Da Isoelectric Point: 5.3353
>NTDB_id=596802 K5E88_RS01110 WP_005719438.1 175301..175801(-) (ssb) [Pasteurella multocida strain Pm3]
MAGVNKVIIVGNLGNDPEIRTMPNGEAVANISVATSESWIDKNTNERREVTEWHRIVFYRRQAEVAGEYLRKGSKVYVEG
RLKTRKWQDQNGQDRYTTEIQGDVLQMLDSRNERQQTGGYAPQTASPQYNAPTGGYGAQPSRPATKPAPQNEPPMDMGFE
EDNIPF
MAGVNKVIIVGNLGNDPEIRTMPNGEAVANISVATSESWIDKNTNERREVTEWHRIVFYRRQAEVAGEYLRKGSKVYVEG
RLKTRKWQDQNGQDRYTTEIQGDVLQMLDSRNERQQTGGYAPQTASPQYNAPTGGYGAQPSRPATKPAPQNEPPMDMGFE
EDNIPF
Nucleotide
Download Length: 501 bp
>NTDB_id=596802 K5E88_RS01110 WP_005719438.1 175301..175801(-) (ssb) [Pasteurella multocida strain Pm3]
ATGGCTGGAGTAAATAAAGTAATTATTGTAGGAAACTTAGGTAACGATCCTGAAATCCGCACAATGCCAAATGGTGAAGC
CGTAGCCAATATCAGCGTCGCGACCAGTGAAAGCTGGATCGACAAAAATACTAACGAACGTCGTGAAGTCACCGAATGGC
ATCGCATCGTATTCTACCGTCGCCAAGCTGAAGTGGCTGGGGAATATCTGCGTAAAGGTTCAAAAGTGTATGTAGAAGGG
CGCCTAAAAACCCGTAAATGGCAAGACCAAAATGGGCAAGACCGCTACACTACCGAGATCCAAGGCGACGTGTTGCAAAT
GCTCGACAGCCGTAACGAACGTCAACAAACCGGCGGCTATGCCCCACAAACCGCTTCGCCACAATATAATGCCCCAACAG
GTGGCTACGGCGCACAACCTTCTCGTCCAGCGACAAAACCCGCTCCACAAAACGAACCTCCAATGGACATGGGCTTTGAG
GAAGATAATATTCCGTTTTAA
ATGGCTGGAGTAAATAAAGTAATTATTGTAGGAAACTTAGGTAACGATCCTGAAATCCGCACAATGCCAAATGGTGAAGC
CGTAGCCAATATCAGCGTCGCGACCAGTGAAAGCTGGATCGACAAAAATACTAACGAACGTCGTGAAGTCACCGAATGGC
ATCGCATCGTATTCTACCGTCGCCAAGCTGAAGTGGCTGGGGAATATCTGCGTAAAGGTTCAAAAGTGTATGTAGAAGGG
CGCCTAAAAACCCGTAAATGGCAAGACCAAAATGGGCAAGACCGCTACACTACCGAGATCCAAGGCGACGTGTTGCAAAT
GCTCGACAGCCGTAACGAACGTCAACAAACCGGCGGCTATGCCCCACAAACCGCTTCGCCACAATATAATGCCCCAACAG
GTGGCTACGGCGCACAACCTTCTCGTCCAGCGACAAAACCCGCTCCACAAAACGAACCTCCAATGGACATGGGCTTTGAG
GAAGATAATATTCCGTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
69.231 |
100 |
0.759 |
| ssb | Vibrio cholerae strain A1552 |
53.591 |
100 |
0.584 |
| ssb | Neisseria meningitidis MC58 |
44.068 |
100 |
0.47 |
| ssb | Neisseria gonorrhoeae MS11 |
44.068 |
100 |
0.47 |