Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | LOCK900_RS04940 | Genome accession | NC_021723 |
| Coordinates | 1034953..1035438 (+) | Length | 161 a.a. |
| NCBI ID | WP_005711354.1 | Uniprot ID | - |
| Organism | Lacticaseibacillus rhamnosus LOCK900 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1025583..1065140 | 1034953..1035438 | within | 0 |
Gene organization within MGE regions
Location: 1025583..1065140
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LOCK900_RS04865 (LOCK900_1053) | - | 1025583..1026767 (-) | 1185 | WP_005714751.1 | tyrosine-type recombinase/integrase | - |
| LOCK900_RS04875 (LOCK900_1055) | - | 1027112..1028113 (-) | 1002 | WP_005714749.1 | hypothetical protein | - |
| LOCK900_RS04880 (LOCK900_1056) | - | 1028227..1028817 (-) | 591 | WP_020751902.1 | DUF5067 domain-containing protein | - |
| LOCK900_RS04885 (LOCK900_1057) | - | 1028877..1029299 (-) | 423 | WP_003594164.1 | ImmA/IrrE family metallo-endopeptidase | - |
| LOCK900_RS04890 | - | 1029289..1029624 (-) | 336 | WP_005714743.1 | helix-turn-helix domain-containing protein | - |
| LOCK900_RS04895 (LOCK900_1058) | - | 1029762..1030004 (+) | 243 | WP_005711333.1 | helix-turn-helix domain-containing protein | - |
| LOCK900_RS15015 (LOCK900_1059) | - | 1030001..1030159 (+) | 159 | WP_005711335.1 | hypothetical protein | - |
| LOCK900_RS04900 (LOCK900_1060) | - | 1030177..1030908 (+) | 732 | WP_005711337.1 | antA/AntB antirepressor family protein | - |
| LOCK900_RS04905 (LOCK900_1061) | - | 1030974..1031522 (+) | 549 | WP_005714742.1 | hypothetical protein | - |
| LOCK900_RS04910 (LOCK900_1062) | - | 1031501..1031731 (+) | 231 | WP_005711341.1 | hypothetical protein | - |
| LOCK900_RS15115 (LOCK900_1063) | - | 1031735..1031863 (+) | 129 | WP_005711343.1 | hypothetical protein | - |
| LOCK900_RS04915 (LOCK900_1064) | - | 1031875..1032102 (+) | 228 | WP_005711345.1 | hypothetical protein | - |
| LOCK900_RS04920 (LOCK900_1065) | - | 1032095..1032298 (+) | 204 | WP_005711347.1 | hypothetical protein | - |
| LOCK900_RS04925 (LOCK900_1066) | - | 1032309..1033184 (+) | 876 | WP_005711348.1 | recombinase RecT | - |
| LOCK900_RS04930 (LOCK900_1067) | - | 1033204..1033968 (+) | 765 | WP_005711350.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| LOCK900_RS04935 (LOCK900_1068) | - | 1033984..1034940 (+) | 957 | WP_005711352.1 | DnaD domain-containing protein | - |
| LOCK900_RS04940 (LOCK900_1069) | ssb | 1034953..1035438 (+) | 486 | WP_005711354.1 | single-stranded DNA-binding protein | Machinery gene |
| LOCK900_RS04945 (LOCK900_1070) | - | 1035746..1035961 (+) | 216 | WP_005711356.1 | helix-turn-helix transcriptional regulator | - |
| LOCK900_RS04950 (LOCK900_1071) | - | 1035958..1036407 (+) | 450 | WP_005711359.1 | hypothetical protein | - |
| LOCK900_RS04955 (LOCK900_1072) | - | 1036454..1036708 (+) | 255 | WP_005711361.1 | hypothetical protein | - |
| LOCK900_RS04960 (LOCK900_1073) | - | 1036705..1037070 (+) | 366 | WP_005714739.1 | hypothetical protein | - |
| LOCK900_RS04965 (LOCK900_1074) | - | 1037083..1037547 (+) | 465 | WP_005711364.1 | hypothetical protein | - |
| LOCK900_RS15060 | - | 1037559..1037810 (+) | 252 | WP_005711366.1 | hypothetical protein | - |
| LOCK900_RS04975 (LOCK900_1075) | - | 1037930..1038436 (+) | 507 | WP_005711368.1 | DUF1642 domain-containing protein | - |
| LOCK900_RS04980 (LOCK900_1076) | - | 1038426..1038776 (+) | 351 | WP_005711370.1 | hypothetical protein | - |
| LOCK900_RS15165 (LOCK900_1077) | - | 1038773..1038981 (+) | 209 | Protein_960 | hypothetical protein | - |
| LOCK900_RS04985 (LOCK900_1078) | - | 1039109..1039330 (+) | 222 | WP_005711376.1 | helix-turn-helix domain-containing protein | - |
| LOCK900_RS04990 | - | 1039539..1039967 (+) | 429 | WP_005711378.1 | hypothetical protein | - |
| LOCK900_RS04995 (LOCK900_1080) | - | 1040300..1041160 (+) | 861 | WP_005711380.1 | hypothetical protein | - |
| LOCK900_RS05000 (LOCK900_1081) | - | 1041701..1042849 (+) | 1149 | WP_005711382.1 | GcrA family cell cycle regulator | - |
| LOCK900_RS05005 | - | 1042842..1043165 (+) | 324 | WP_005711383.1 | hypothetical protein | - |
| LOCK900_RS05010 (LOCK900_1083) | - | 1043202..1043735 (+) | 534 | WP_005711385.1 | terminase small subunit | - |
| LOCK900_RS05015 (LOCK900_1084) | - | 1043713..1045068 (+) | 1356 | WP_005714737.1 | PBSX family phage terminase large subunit | - |
| LOCK900_RS05020 (LOCK900_1085) | - | 1045073..1046461 (+) | 1389 | WP_005711389.1 | phage portal protein | - |
| LOCK900_RS05025 (LOCK900_1086) | - | 1046464..1048206 (+) | 1743 | WP_005711391.1 | minor capsid protein | - |
| LOCK900_RS05030 (LOCK900_1087) | - | 1048355..1049011 (+) | 657 | WP_005711393.1 | DUF4355 domain-containing protein | - |
| LOCK900_RS05035 (LOCK900_1088) | - | 1049027..1050040 (+) | 1014 | WP_005711395.1 | hypothetical protein | - |
| LOCK900_RS05040 (LOCK900_1089) | - | 1050268..1050642 (+) | 375 | WP_005711397.1 | phage head-tail connector protein | - |
| LOCK900_RS05045 (LOCK900_1090) | - | 1050647..1050949 (+) | 303 | WP_005711399.1 | hypothetical protein | - |
| LOCK900_RS05050 (LOCK900_1091) | - | 1050946..1051311 (+) | 366 | WP_005711401.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| LOCK900_RS05055 (LOCK900_1092) | - | 1051312..1051716 (+) | 405 | WP_003582636.1 | DUF3168 domain-containing protein | - |
| LOCK900_RS05060 (LOCK900_1093) | - | 1051728..1052333 (+) | 606 | WP_005711403.1 | phage tail tube protein | - |
| LOCK900_RS05065 (LOCK900_1094) | - | 1052420..1052752 (+) | 333 | WP_005711405.1 | tail assembly chaperone | - |
| LOCK900_RS05070 (LOCK900_1095) | - | 1052857..1053210 (+) | 354 | WP_005711407.1 | hypothetical protein | - |
| LOCK900_RS05075 (LOCK900_1096) | - | 1053203..1056292 (+) | 3090 | WP_005711409.1 | tape measure protein | - |
| LOCK900_RS05080 (LOCK900_1097) | - | 1056293..1058281 (+) | 1989 | WP_005714730.1 | distal tail protein Dit | - |
| LOCK900_RS05085 (LOCK900_1098) | - | 1058282..1060717 (+) | 2436 | WP_020751906.1 | phage tail protein | - |
| LOCK900_RS05090 (LOCK900_1099) | - | 1060719..1061009 (+) | 291 | WP_005713395.1 | hypothetical protein | - |
| LOCK900_RS15065 | - | 1061002..1061133 (+) | 132 | WP_005714777.1 | XkdX family protein | - |
| LOCK900_RS05100 (LOCK900_1100) | - | 1061163..1061453 (+) | 291 | WP_005714776.1 | hypothetical protein | - |
| LOCK900_RS05105 (LOCK900_1101) | - | 1061446..1061892 (+) | 447 | WP_005714775.1 | phage holin | - |
| LOCK900_RS05110 (LOCK900_1102) | - | 1061903..1063087 (+) | 1185 | WP_005713391.1 | GH25 family lysozyme | - |
| LOCK900_RS15170 (LOCK900_1103) | - | 1063285..1063359 (+) | 75 | Protein_987 | glucose-6-phosphate isomerase | - |
| LOCK900_RS05115 (LOCK900_1105) | - | 1063707..1063994 (-) | 288 | WP_005713389.1 | putative quinol monooxygenase | - |
| LOCK900_RS05120 (LOCK900_1106) | - | 1064289..1065140 (-) | 852 | WP_005713388.1 | DNA/RNA non-specific endonuclease | - |
Sequence
Protein
Download Length: 161 a.a. Molecular weight: 17645.39 Da Isoelectric Point: 7.9701
>NTDB_id=59598 LOCK900_RS04940 WP_005711354.1 1034953..1035438(+) (ssb) [Lacticaseibacillus rhamnosus LOCK900]
MLNSVSLTGRLTRDVDLRYTQSGTAAGSFTLAVDRKFKSKNGERETDFVNCQIWRKSAENFANFTKKGSLVGVEGRIQTR
TYDNAQGQKIFVTEVIVDNFALLESRQTSQNSPKSQQTVNASAAATTNASQTTPNASRANTTDPFANNGQPIDIQDDDLP
F
MLNSVSLTGRLTRDVDLRYTQSGTAAGSFTLAVDRKFKSKNGERETDFVNCQIWRKSAENFANFTKKGSLVGVEGRIQTR
TYDNAQGQKIFVTEVIVDNFALLESRQTSQNSPKSQQTVNASAAATTNASQTTPNASRANTTDPFANNGQPIDIQDDDLP
F
Nucleotide
Download Length: 486 bp
>NTDB_id=59598 LOCK900_RS04940 WP_005711354.1 1034953..1035438(+) (ssb) [Lacticaseibacillus rhamnosus LOCK900]
TTGCTAAACAGTGTCTCACTAACAGGCCGGCTGACAAGAGATGTTGACTTGCGTTACACGCAAAGTGGCACGGCGGCAGG
ATCATTCACGCTGGCCGTTGACCGCAAATTCAAGAGCAAAAACGGAGAACGAGAAACTGATTTCGTAAATTGCCAGATTT
GGCGCAAGTCGGCTGAGAACTTTGCAAACTTCACCAAAAAAGGATCCTTGGTTGGTGTGGAAGGCCGTATTCAAACGCGT
ACGTACGATAACGCGCAAGGGCAGAAAATATTCGTGACCGAGGTAATCGTTGATAATTTTGCTTTGCTTGAGTCACGACA
GACGTCTCAGAACAGTCCTAAATCACAGCAAACAGTCAATGCATCAGCAGCAGCGACCACAAACGCGAGTCAAACGACTC
CAAATGCTTCACGAGCGAATACCACGGATCCGTTTGCTAATAATGGCCAGCCGATAGACATCCAAGATGATGATTTGCCA
TTTTAA
TTGCTAAACAGTGTCTCACTAACAGGCCGGCTGACAAGAGATGTTGACTTGCGTTACACGCAAAGTGGCACGGCGGCAGG
ATCATTCACGCTGGCCGTTGACCGCAAATTCAAGAGCAAAAACGGAGAACGAGAAACTGATTTCGTAAATTGCCAGATTT
GGCGCAAGTCGGCTGAGAACTTTGCAAACTTCACCAAAAAAGGATCCTTGGTTGGTGTGGAAGGCCGTATTCAAACGCGT
ACGTACGATAACGCGCAAGGGCAGAAAATATTCGTGACCGAGGTAATCGTTGATAATTTTGCTTTGCTTGAGTCACGACA
GACGTCTCAGAACAGTCCTAAATCACAGCAAACAGTCAATGCATCAGCAGCAGCGACCACAAACGCGAGTCAAACGACTC
CAAATGCTTCACGAGCGAATACCACGGATCCGTTTGCTAATAATGGCCAGCCGATAGACATCCAAGATGATGATTTGCCA
TTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
62.791 |
100 |
0.671 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
49.419 |
100 |
0.528 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
54.717 |
65.839 |
0.36 |
| ssb | Neisseria meningitidis MC58 |
33.526 |
100 |
0.36 |