Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   JMO12_RS01795 Genome accession   NZ_CP080552
Coordinates   406506..407009 (+) Length   167 a.a.
NCBI ID   WP_000934799.1    Uniprot ID   A0A7U7IE99
Organism   Staphylococcus aureus strain HL18807     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 407441..462210 406506..407009 flank 432


Gene organization within MGE regions


Location: 406506..462210
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JMO12_RS01795 (JMO12_000360) ssbA 406506..407009 (+) 504 WP_000934799.1 single-stranded DNA-binding protein Machinery gene
  JMO12_RS01800 (JMO12_000361) rpsR 407061..407303 (+) 243 WP_000897044.1 30S ribosomal protein S18 -
  JMO12_RS01805 (JMO12_000362) - 407579..408517 (-) 939 WP_001817700.1 Abi family protein -
  JMO12_RS01810 (JMO12_000363) - 408556..409269 (-) 714 Protein_365 tyrosine-type recombinase/integrase -
  JMO12_RS01815 (JMO12_000364) selX 409475..410086 (+) 612 WP_000475325.1 staphylococcal enterotoxin-like toxin X -
  JMO12_RS01820 (JMO12_000365) - 410455..410823 (+) 369 WP_000849163.1 YxeA family protein -
  JMO12_RS01825 (JMO12_000366) - 411004..411576 (+) 573 WP_000769722.1 PepSY domain-containing protein -
  JMO12_RS01830 (JMO12_000367) - 411713..411976 (-) 264 WP_001055897.1 helix-turn-helix transcriptional regulator -
  JMO12_RS01835 (JMO12_000368) - 412276..412527 (+) 252 WP_000466748.1 GlsB/YeaQ/YmgE family stress response membrane protein -
  JMO12_RS01840 (JMO12_000369) - 412566..412775 (-) 210 WP_000211677.1 hypothetical protein -
  JMO12_RS01845 (JMO12_000370) - 412953..413534 (+) 582 WP_000158375.1 histidine phosphatase family protein -
  JMO12_RS01850 (JMO12_000371) - 413600..413983 (-) 384 WP_000868259.1 hypothetical protein -
  JMO12_RS01855 (JMO12_000372) - 414253..414879 (-) 627 WP_000746679.1 NDxxF motif lipoprotein -
  JMO12_RS01860 (JMO12_000373) - 414952..415187 (-) 236 Protein_375 hypothetical protein -
  JMO12_RS01865 (JMO12_000374) ahpF 415323..416846 (-) 1524 WP_000930514.1 alkyl hydroperoxide reductase subunit F -
  JMO12_RS01870 (JMO12_000375) ahpC 416862..417431 (-) 570 WP_000052781.1 alkyl hydroperoxide reductase subunit C -
  JMO12_RS01875 (JMO12_000376) nfsA 417923..418678 (+) 756 WP_114914751.1 oxygen-insensitive NADPH nitroreductase -
  JMO12_RS01880 (JMO12_000377) - 418758..420146 (-) 1389 WP_220360775.1 L-cystine transporter -
  JMO12_RS01885 (JMO12_000378) - 420231..420329 (+) 99 WP_001792089.1 hypothetical protein -
  JMO12_RS01890 (JMO12_000379) - 420993..422312 (+) 1320 WP_001557163.1 ISL3-like element IS1181 family transposase -
  JMO12_RS14695 - 422360..422431 (+) 72 WP_370591525.1 hypothetical protein -
  JMO12_RS01895 (JMO12_000380) - 422644..423600 (-) 957 WP_000956137.1 hypothetical protein -
  JMO12_RS01900 (JMO12_000381) - 423718..424380 (-) 663 WP_000394698.1 hypothetical protein -
  JMO12_RS01905 (JMO12_000382) - 424523..424930 (-) 408 WP_000763767.1 general stress protein -
  JMO12_RS01910 (JMO12_000383) xpt 425443..426021 (+) 579 WP_000421410.1 xanthine phosphoribosyltransferase -
  JMO12_RS01915 (JMO12_000384) pbuX 426021..427289 (+) 1269 WP_000793018.1 xanthine permease PbuX -
  JMO12_RS01920 (JMO12_000385) guaB 427327..428793 (+) 1467 WP_000264071.1 IMP dehydrogenase -
  JMO12_RS01925 (JMO12_000386) guaA 428818..430359 (+) 1542 WP_000424963.1 glutamine-hydrolyzing GMP synthase -
  JMO12_RS01930 (JMO12_000387) - 430427..431620 (-) 1194 WP_000237797.1 site-specific integrase -
  JMO12_RS01935 (JMO12_000388) - 431647..431847 (-) 201 WP_000633907.1 DUF3173 family protein -
  JMO12_RS01940 (JMO12_000389) - 432345..432575 (-) 231 WP_000845143.1 helix-turn-helix domain-containing protein -
  JMO12_RS01945 (JMO12_000390) - 432572..432994 (-) 423 WP_000804879.1 RNA polymerase sigma factor -
  JMO12_RS01955 (JMO12_000392) - 433525..433878 (+) 354 WP_001227350.1 helix-turn-helix domain-containing protein -
  JMO12_RS01960 (JMO12_000393) - 433936..434124 (-) 189 WP_032506803.1 cysteine-rich KTR domain-containing protein -
  JMO12_RS01965 (JMO12_000394) tet(M) 434222..436141 (-) 1920 WP_000691737.1 tetracycline resistance ribosomal protection protein Tet(M) -
  JMO12_RS01970 (JMO12_000395) - 436157..436273 (-) 117 WP_001791010.1 tetracycline resistance determinant leader peptide -
  JMO12_RS01975 (JMO12_000396) - 436518..437447 (-) 930 WP_000584387.1 conjugal transfer protein -
  JMO12_RS01980 (JMO12_000397) - 437464..438486 (-) 1023 WP_000768373.1 bifunctional lytic transglycosylase/C40 family peptidase -
  JMO12_RS01985 (JMO12_000398) - 438483..440510 (-) 2028 WP_000192393.1 CD3337/EF1877 family mobilome membrane protein -
  JMO12_RS01990 (JMO12_000399) - 440507..442960 (-) 2454 WP_000331165.1 ATP-binding protein -
  JMO12_RS01995 (JMO12_000400) - 442944..443339 (-) 396 WP_000723887.1 conjugal transfer protein -
  JMO12_RS02000 (JMO12_000401) - 443411..444049 (-) 639 WP_000248477.1 DUF6037 family protein -
  JMO12_RS02005 (JMO12_000402) - 444105..444605 (-) 501 WP_000425404.1 antirestriction protein ArdA -
  JMO12_RS02010 (JMO12_000403) - 444666..445445 (-) 780 WP_000675717.1 abortive infection family protein -
  JMO12_RS02015 (JMO12_000404) - 445487..445708 (-) 222 WP_001009054.1 hypothetical protein -
  JMO12_RS02020 (JMO12_000405) - 445705..445995 (-) 291 WP_000055376.1 hypothetical protein -
  JMO12_RS02025 (JMO12_000406) mobT 445992..447176 (-) 1185 WP_000426689.1 MobT family relaxase -
  JMO12_RS02030 (JMO12_000407) - 447358..448761 (-) 1404 WP_001130244.1 FtsK/SpoIIIE domain-containing protein -
  JMO12_RS02035 (JMO12_000408) - 448783..449556 (-) 774 WP_000185761.1 hypothetical protein -
  JMO12_RS02040 (JMO12_000409) - 449566..449943 (-) 378 WP_001234191.1 YdcP family protein -
  JMO12_RS02045 (JMO12_000410) - 449964..450278 (-) 315 WP_000421279.1 YdcP family protein -
  JMO12_RS02050 (JMO12_000411) - 450478..452270 (-) 1793 Protein_413 UvrD-helicase domain-containing protein -
  JMO12_RS02055 (JMO12_000412) - 452267..454456 (-) 2190 WP_000470931.1 ATP-dependent endonuclease -
  JMO12_RS02060 (JMO12_000413) - 454590..455780 (-) 1191 WP_000997694.1 IS256-like element ISLgar5 family transposase -
  JMO12_RS02065 (JMO12_000414) - 456274..456810 (-) 537 WP_000551643.1 hypothetical protein -
  JMO12_RS02070 (JMO12_000415) - 457202..457906 (-) 705 WP_000041880.1 type II toxin-antitoxin system PemK/MazF family toxin -
  JMO12_RS02075 (JMO12_000416) - 458305..458577 (-) 273 WP_000159787.1 transposase -
  JMO12_RS02080 (JMO12_000417) - 458838..458990 (-) 153 WP_000248844.1 hypothetical protein -
  JMO12_RS02085 (JMO12_000418) - 459522..459881 (-) 360 WP_001021623.1 DUF1304 domain-containing protein -
  JMO12_RS02090 (JMO12_000419) - 459900..460745 (-) 846 WP_001024371.1 SDR family oxidoreductase -
  JMO12_RS02095 (JMO12_000420) - 461217..461897 (+) 681 WP_000669014.1 superantigen-like protein SSL1 -

Sequence


Protein


Download         Length: 167 a.a.        Molecular weight: 18539.12 Da        Isoelectric Point: 4.7305

>NTDB_id=593789 JMO12_RS01795 WP_000934799.1 406506..407009(+) (ssbA) [Staphylococcus aureus strain HL18807]
MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFINCVVFRRQADNVNNYLSKGSLAGVDGRLQSR
NYENQEGRRVFVTEVVCDSVQFLEPKNAQQNGGQRQQNEFQDYGQGFGGQQSGQNNSYNNSSNTKQSDNPFANANGPIDI
SDDDLPF

Nucleotide


Download         Length: 504 bp        

>NTDB_id=593789 JMO12_RS01795 WP_000934799.1 406506..407009(+) (ssbA) [Staphylococcus aureus strain HL18807]
ATGCTAAATAGAGTTGTATTAGTAGGTCGTTTAACGAAAGATCCGGAATACAGAACCACTCCCTCAGGTGTGAGTGTAGC
GACATTCACTCTTGCAGTAAATCGTACGTTCACGAATGCTCAAGGGGAGCGCGAAGCAGATTTTATTAACTGTGTTGTTT
TTAGAAGACAAGCAGATAATGTAAATAACTATTTATCTAAAGGTAGTTTAGCTGGTGTAGATGGTCGCTTACAATCCCGT
AATTATGAAAATCAAGAAGGTCGTCGTGTGTTTGTTACTGAAGTTGTGTGTGATAGCGTTCAATTCCTTGAACCTAAAAA
TGCGCAACAAAATGGTGGCCAACGTCAACAAAATGAATTCCAAGATTACGGTCAAGGATTCGGTGGTCAACAATCAGGAC
AAAACAATTCGTACAATAATTCATCAAACACGAAACAATCTGATAATCCATTTGCAAATGCAAACGGACCGATTGATATA
AGTGATGATGACTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A7U7IE99

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

65.341

100

0.689

  ssb Latilactobacillus sakei subsp. sakei 23K

54.971

100

0.563

  ssbB Bacillus subtilis subsp. subtilis str. 168

58.491

63.473

0.371

  ssb Glaesserella parasuis strain SC1401

34.463

100

0.365