Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   K0V03_RS01425 Genome accession   NZ_CP080508
Coordinates   243022..243405 (-) Length   127 a.a.
NCBI ID   WP_085186490.1    Uniprot ID   -
Organism   Bacillus subtilis strain HD15     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 238022..248405
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K0V03_RS01385 (K0V03_01385) sinI 238956..239129 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  K0V03_RS01390 (K0V03_01390) sinR 239163..239498 (+) 336 WP_121548932.1 transcriptional regulator SinR Regulator
  K0V03_RS01395 (K0V03_01395) tasA 239591..240376 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  K0V03_RS01400 (K0V03_01400) sipW 240440..241012 (-) 573 WP_003230181.1 signal peptidase I SipW -
  K0V03_RS01405 (K0V03_01405) tapA 240996..241757 (-) 762 WP_085186488.1 amyloid fiber anchoring/assembly protein TapA -
  K0V03_RS01410 (K0V03_01410) yqzG 242028..242354 (+) 327 WP_085186489.1 YqzG/YhdC family protein -
  K0V03_RS01415 (K0V03_01415) spoIITA 242396..242575 (-) 180 WP_003230176.1 YqzE family protein -
  K0V03_RS01420 (K0V03_01420) comGG 242647..243021 (-) 375 WP_021480019.1 ComG operon protein ComGG Machinery gene
  K0V03_RS01425 (K0V03_01425) comGF 243022..243405 (-) 384 WP_085186490.1 ComG operon protein ComGF Machinery gene
  K0V03_RS01430 (K0V03_01430) comGE 243431..243778 (-) 348 WP_046160583.1 ComG operon protein 5 Machinery gene
  K0V03_RS01435 (K0V03_01435) comGD 243762..244193 (-) 432 WP_024573390.1 comG operon protein ComGD Machinery gene
  K0V03_RS01440 (K0V03_01440) comGC 244183..244479 (-) 297 WP_024573391.1 comG operon protein ComGC Machinery gene
  K0V03_RS01445 (K0V03_01445) comGB 244493..245530 (-) 1038 WP_085186491.1 comG operon protein ComGB Machinery gene
  K0V03_RS01450 (K0V03_01450) comGA 245517..246587 (-) 1071 WP_085186492.1 competence protein ComGA Machinery gene
  K0V03_RS22135 - 246605..246997 (-) 393 WP_170948341.1 hypothetical protein -
  K0V03_RS01460 (K0V03_01460) corA 246999..247952 (-) 954 WP_015483432.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14303.34 Da        Isoelectric Point: 5.8949

>NTDB_id=593286 K0V03_RS01425 WP_085186490.1 243022..243405(-) (comGF) [Bacillus subtilis strain HD15]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMVSIEQMMNECKESQAVKTAEHGSVLTCTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=593286 K0V03_RS01425 WP_085186490.1 243022..243405(-) (comGF) [Bacillus subtilis strain HD15]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGGTTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAACCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

96.85

100

0.969