Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | K0H57_RS04540 | Genome accession | NZ_CP080397 |
| Coordinates | 924522..924998 (+) | Length | 158 a.a. |
| NCBI ID | WP_008840867.1 | Uniprot ID | A0AAW8YED4 |
| Organism | Pediococcus acidilactici strain PMC202 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 912202..934850 | 924522..924998 | within | 0 |
Gene organization within MGE regions
Location: 912202..934850
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| K0H57_RS04415 (K0H57_04415) | fabI | 912202..912960 (+) | 759 | WP_008842116.1 | enoyl-ACP reductase FabI | - |
| K0H57_RS04420 (K0H57_04420) | - | 913088..914263 (-) | 1176 | WP_166481432.1 | tyrosine-type recombinase/integrase | - |
| K0H57_RS04425 (K0H57_04425) | - | 914351..914620 (-) | 270 | WP_008842114.1 | hypothetical protein | - |
| K0H57_RS04430 (K0H57_04430) | - | 914702..915229 (-) | 528 | WP_008842113.1 | PIN domain-containing protein | - |
| K0H57_RS04435 (K0H57_04435) | - | 915222..915557 (-) | 336 | WP_166481433.1 | STAS-like domain-containing protein | - |
| K0H57_RS04440 (K0H57_04440) | - | 915587..916483 (-) | 897 | WP_166481434.1 | hypothetical protein | - |
| K0H57_RS04445 (K0H57_04445) | - | 916562..917326 (-) | 765 | WP_008840851.1 | DUF4352 domain-containing protein | - |
| K0H57_RS04450 (K0H57_04450) | - | 917395..917802 (-) | 408 | WP_036685006.1 | ImmA/IrrE family metallo-endopeptidase | - |
| K0H57_RS04455 (K0H57_04455) | - | 917814..918176 (-) | 363 | WP_008840853.1 | helix-turn-helix domain-containing protein | - |
| K0H57_RS04460 (K0H57_04460) | - | 918319..918549 (+) | 231 | WP_008840854.1 | helix-turn-helix transcriptional regulator | - |
| K0H57_RS04465 (K0H57_04465) | - | 918546..918683 (+) | 138 | WP_008840855.1 | hypothetical protein | - |
| K0H57_RS04470 (K0H57_04470) | - | 918715..919083 (+) | 369 | WP_036685008.1 | hypothetical protein | - |
| K0H57_RS04475 (K0H57_04475) | - | 919075..919272 (-) | 198 | WP_166481435.1 | hypothetical protein | - |
| K0H57_RS04480 (K0H57_04480) | - | 919341..919556 (+) | 216 | WP_036685013.1 | hypothetical protein | - |
| K0H57_RS04485 (K0H57_04485) | - | 919641..920105 (+) | 465 | WP_232623517.1 | helix-turn-helix transcriptional regulator | - |
| K0H57_RS04490 (K0H57_04490) | - | 920106..920387 (+) | 282 | WP_008840858.1 | hypothetical protein | - |
| K0H57_RS04495 (K0H57_04495) | - | 920389..920532 (+) | 144 | WP_158002712.1 | hypothetical protein | - |
| K0H57_RS04500 (K0H57_04500) | - | 920625..920870 (+) | 246 | WP_008840859.1 | hypothetical protein | - |
| K0H57_RS04505 (K0H57_04505) | bet | 920863..921660 (+) | 798 | WP_008840860.1 | phage recombination protein Bet | - |
| K0H57_RS04510 (K0H57_04510) | - | 921569..922450 (+) | 882 | WP_052017552.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| K0H57_RS04515 (K0H57_04515) | - | 922462..922926 (+) | 465 | WP_008840862.1 | hypothetical protein | - |
| K0H57_RS04520 (K0H57_04520) | - | 922953..923636 (+) | 684 | WP_008840863.1 | putative HNHc nuclease | - |
| K0H57_RS04525 (K0H57_04525) | - | 923620..924027 (+) | 408 | WP_036685016.1 | hypothetical protein | - |
| K0H57_RS04530 (K0H57_04530) | - | 924048..924278 (+) | 231 | WP_008840865.1 | helix-turn-helix domain-containing protein | - |
| K0H57_RS04535 (K0H57_04535) | - | 924320..924529 (+) | 210 | WP_008840866.1 | hypothetical protein | - |
| K0H57_RS04540 (K0H57_04540) | ssb | 924522..924998 (+) | 477 | WP_008840867.1 | single-stranded DNA-binding protein | Machinery gene |
| K0H57_RS04545 (K0H57_04545) | - | 925010..925315 (+) | 306 | WP_036685019.1 | helix-turn-helix domain-containing protein | - |
| K0H57_RS04550 (K0H57_04550) | - | 925429..925665 (+) | 237 | WP_036685021.1 | hypothetical protein | - |
| K0H57_RS04555 (K0H57_04555) | - | 925658..925894 (+) | 237 | WP_008840869.1 | hypothetical protein | - |
| K0H57_RS04565 (K0H57_04565) | - | 926827..927642 (+) | 816 | WP_008840871.1 | abortive infection family protein | - |
| K0H57_RS04570 (K0H57_04570) | - | 927775..928602 (+) | 828 | WP_036685027.1 | hypothetical protein | - |
| K0H57_RS10070 | - | 928655..929002 (+) | 348 | WP_052017554.1 | helix-turn-helix domain-containing protein | - |
| K0H57_RS10075 | - | 929016..929327 (+) | 312 | WP_008840873.1 | hypothetical protein | - |
| K0H57_RS04580 (K0H57_04580) | - | 929324..930622 (+) | 1299 | WP_166481436.1 | PBSX family phage terminase large subunit | - |
| K0H57_RS04585 (K0H57_04585) | - | 930956..932125 (+) | 1170 | WP_036685030.1 | hydroxymethylglutaryl-CoA synthase | - |
| K0H57_RS04590 (K0H57_04590) | - | 932227..932835 (-) | 609 | WP_008840876.1 | hypothetical protein | - |
| K0H57_RS04595 (K0H57_04595) | lexA | 932916..933545 (-) | 630 | WP_002831524.1 | transcriptional repressor LexA | - |
| K0H57_RS04600 (K0H57_04600) | - | 933652..933900 (+) | 249 | WP_008840877.1 | DUF896 domain-containing protein | - |
| K0H57_RS04605 (K0H57_04605) | - | 933970..934191 (+) | 222 | WP_002831526.1 | YneF family protein | - |
| K0H57_RS04610 (K0H57_04610) | - | 934203..934850 (-) | 648 | WP_002831527.1 | 1-acyl-sn-glycerol-3-phosphate acyltransferase | - |
Sequence
Protein
Download Length: 158 a.a. Molecular weight: 17648.30 Da Isoelectric Point: 4.5762
>NTDB_id=592491 K0H57_RS04540 WP_008840867.1 924522..924998(+) (ssb) [Pediococcus acidilactici strain PMC202]
MINRAVLIGRLTRDPELKYTTNGVAVASFNLAVNRQFTNQDGEREADFINCVMWRKAAEIFCDYTHKGSLVGIDGRIQTR
SYENQQGQRVYVTEVVADNFSFLESKSQSNQNNGSYVPQDNGFGQNNGPTTPNNTNPNDPFSGKQGQSIDITDEDLPF
MINRAVLIGRLTRDPELKYTTNGVAVASFNLAVNRQFTNQDGEREADFINCVMWRKAAEIFCDYTHKGSLVGIDGRIQTR
SYENQQGQRVYVTEVVADNFSFLESKSQSNQNNGSYVPQDNGFGQNNGPTTPNNTNPNDPFSGKQGQSIDITDEDLPF
Nucleotide
Download Length: 477 bp
>NTDB_id=592491 K0H57_RS04540 WP_008840867.1 924522..924998(+) (ssb) [Pediococcus acidilactici strain PMC202]
ATGATTAACCGAGCGGTATTAATCGGGCGCTTAACAAGGGACCCAGAACTAAAGTACACAACCAATGGCGTAGCGGTCGC
TAGCTTTAACCTAGCAGTCAATCGCCAATTCACAAACCAAGATGGCGAACGTGAAGCAGATTTTATCAATTGCGTAATGT
GGCGGAAAGCGGCAGAAATTTTCTGCGACTATACTCACAAAGGTTCGTTGGTTGGCATTGATGGACGAATCCAAACTCGT
TCATACGAAAATCAACAAGGACAACGTGTTTATGTCACTGAAGTGGTCGCGGATAACTTTTCCTTTTTGGAATCTAAAAG
TCAGAGCAATCAAAACAATGGCAGTTATGTGCCACAAGACAACGGGTTTGGTCAAAATAATGGGCCAACTACGCCGAATA
ACACGAACCCAAATGATCCGTTTAGCGGAAAGCAAGGACAATCCATTGATATCACCGATGAAGATTTACCGTTCTAG
ATGATTAACCGAGCGGTATTAATCGGGCGCTTAACAAGGGACCCAGAACTAAAGTACACAACCAATGGCGTAGCGGTCGC
TAGCTTTAACCTAGCAGTCAATCGCCAATTCACAAACCAAGATGGCGAACGTGAAGCAGATTTTATCAATTGCGTAATGT
GGCGGAAAGCGGCAGAAATTTTCTGCGACTATACTCACAAAGGTTCGTTGGTTGGCATTGATGGACGAATCCAAACTCGT
TCATACGAAAATCAACAAGGACAACGTGTTTATGTCACTGAAGTGGTCGCGGATAACTTTTCCTTTTTGGAATCTAAAAG
TCAGAGCAATCAAAACAATGGCAGTTATGTGCCACAAGACAACGGGTTTGGTCAAAATAATGGGCCAACTACGCCGAATA
ACACGAACCCAAATGATCCGTTTAGCGGAAAGCAAGGACAATCCATTGATATCACCGATGAAGATTTACCGTTCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
57.895 |
100 |
0.627 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.491 |
100 |
0.608 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.089 |
0.399 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
51.282 |
74.051 |
0.38 |