Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   KXY09_RS12635 Genome accession   NZ_CP079719
Coordinates   2606042..2606479 (-) Length   145 a.a.
NCBI ID   WP_052827646.1    Uniprot ID   -
Organism   Bacillus velezensis strain LABIM44     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2601042..2611479
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KXY09_RS12585 (KXY09_12580) sinI 2601426..2601599 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  KXY09_RS12590 (KXY09_12585) sinR 2601633..2601968 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  KXY09_RS12595 (KXY09_12590) tasA 2602016..2602801 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  KXY09_RS12600 (KXY09_12595) sipW 2602866..2603450 (-) 585 WP_371877457.1 signal peptidase I SipW -
  KXY09_RS12605 (KXY09_12600) tapA 2603422..2604093 (-) 672 WP_015240206.1 amyloid fiber anchoring/assembly protein TapA -
  KXY09_RS12610 (KXY09_12605) - 2604352..2604681 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  KXY09_RS12615 (KXY09_12610) - 2604721..2604900 (-) 180 WP_003153093.1 YqzE family protein -
  KXY09_RS12620 (KXY09_12615) comGG 2604957..2605334 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  KXY09_RS12625 (KXY09_12620) comGF 2605335..2605835 (-) 501 WP_257474763.1 competence type IV pilus minor pilin ComGF -
  KXY09_RS12630 (KXY09_12625) comGE 2605744..2606058 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  KXY09_RS12635 (KXY09_12630) comGD 2606042..2606479 (-) 438 WP_052827646.1 competence type IV pilus minor pilin ComGD Machinery gene
  KXY09_RS12640 (KXY09_12635) comGC 2606469..2606777 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  KXY09_RS12645 (KXY09_12640) comGB 2606782..2607819 (-) 1038 WP_168985054.1 competence type IV pilus assembly protein ComGB Machinery gene
  KXY09_RS12650 (KXY09_12645) comGA 2607806..2608876 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  KXY09_RS12655 (KXY09_12650) - 2609073..2610023 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -
  KXY09_RS12660 (KXY09_12655) - 2610169..2611470 (+) 1302 WP_021494315.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16263.70 Da        Isoelectric Point: 10.2475

>NTDB_id=588912 KXY09_RS12635 WP_052827646.1 2606042..2606479(-) (comGD) [Bacillus velezensis strain LABIM44]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPAYTHLAVRQKTEQLQKDIQLAQETAIAENKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=588912 KXY09_RS12635 WP_052827646.1 2606042..2606479(-) (comGD) [Bacillus velezensis strain LABIM44]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGCCTACACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAAAATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGACTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACGGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.849

100

0.572