Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   KXY09_RS12585 Genome accession   NZ_CP079719
Coordinates   2601426..2601599 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain LABIM44     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2596426..2606599
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KXY09_RS12570 (KXY09_12565) gcvT 2597239..2598339 (-) 1101 WP_012117974.1 glycine cleavage system aminomethyltransferase GcvT -
  KXY09_RS12575 (KXY09_12570) - 2598763..2600433 (+) 1671 WP_025284995.1 DEAD/DEAH box helicase -
  KXY09_RS12580 (KXY09_12575) - 2600455..2601249 (+) 795 WP_136396493.1 YqhG family protein -
  KXY09_RS12585 (KXY09_12580) sinI 2601426..2601599 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  KXY09_RS12590 (KXY09_12585) sinR 2601633..2601968 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  KXY09_RS12595 (KXY09_12590) tasA 2602016..2602801 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  KXY09_RS12600 (KXY09_12595) sipW 2602866..2603450 (-) 585 WP_371877457.1 signal peptidase I SipW -
  KXY09_RS12605 (KXY09_12600) tapA 2603422..2604093 (-) 672 WP_015240206.1 amyloid fiber anchoring/assembly protein TapA -
  KXY09_RS12610 (KXY09_12605) - 2604352..2604681 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  KXY09_RS12615 (KXY09_12610) - 2604721..2604900 (-) 180 WP_003153093.1 YqzE family protein -
  KXY09_RS12620 (KXY09_12615) comGG 2604957..2605334 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  KXY09_RS12625 (KXY09_12620) comGF 2605335..2605835 (-) 501 WP_257474763.1 competence type IV pilus minor pilin ComGF -
  KXY09_RS12630 (KXY09_12625) comGE 2605744..2606058 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  KXY09_RS12635 (KXY09_12630) comGD 2606042..2606479 (-) 438 WP_052827646.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=588909 KXY09_RS12585 WP_003153105.1 2601426..2601599(+) (sinI) [Bacillus velezensis strain LABIM44]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=588909 KXY09_RS12585 WP_003153105.1 2601426..2601599(+) (sinI) [Bacillus velezensis strain LABIM44]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702