Detailed information
Bioinformatically predicted
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | KVY10_RS07885 | Genome accession | NZ_CP078162 |
| Coordinates | 1642911..1643186 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain NS2 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1637911..1648186
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KVY10_RS07850 (KVY10_07850) | - | 1638466..1638939 (+) | 474 | WP_002357065.1 | universal stress protein | - |
| KVY10_RS07855 (KVY10_07855) | - | 1639051..1640238 (-) | 1188 | WP_002357064.1 | acetate/propionate family kinase | - |
| KVY10_RS07860 (KVY10_07860) | - | 1640263..1641270 (-) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| KVY10_RS07865 (KVY10_07865) | comGG | 1641399..1641752 (-) | 354 | WP_033626584.1 | competence type IV pilus minor pilin ComGG | - |
| KVY10_RS07870 (KVY10_07870) | comGF | 1641752..1642186 (-) | 435 | WP_002362055.1 | competence type IV pilus minor pilin ComGF | - |
| KVY10_RS07875 (KVY10_07875) | - | 1642176..1642502 (-) | 327 | WP_002370967.1 | type II secretion system protein | - |
| KVY10_RS07880 (KVY10_07880) | comGD | 1642468..1642914 (-) | 447 | WP_002366895.1 | competence type IV pilus minor pilin ComGD | - |
| KVY10_RS07885 (KVY10_07885) | comGC/cglC | 1642911..1643186 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| KVY10_RS07890 (KVY10_07890) | comGB | 1643186..1644232 (-) | 1047 | WP_218391168.1 | competence type IV pilus assembly protein ComGB | - |
| KVY10_RS07895 (KVY10_07895) | comGA | 1644189..1645157 (-) | 969 | WP_002364362.1 | competence type IV pilus ATPase ComGA | - |
| KVY10_RS07900 (KVY10_07900) | - | 1645397..1646725 (-) | 1329 | WP_002362058.1 | APC family permease | - |
| KVY10_RS07905 (KVY10_07905) | rlmN | 1647015..1648088 (-) | 1074 | WP_002356987.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=587455 KVY10_RS07885 WP_002356991.1 1642911..1643186(-) (comGC/cglC) [Enterococcus faecalis strain NS2]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=587455 KVY10_RS07885 WP_002356991.1 1642911..1643186(-) (comGC/cglC) [Enterococcus faecalis strain NS2]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |