Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | KU525_RS06715 | Genome accession | NZ_CP077920 |
| Coordinates | 1383441..1383911 (+) | Length | 156 a.a. |
| NCBI ID | WP_000610648.1 | Uniprot ID | A0A090M1W2 |
| Organism | Staphylococcus aureus strain 277 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1368256..1413200 | 1383441..1383911 | within | 0 |
Gene organization within MGE regions
Location: 1368256..1413200
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KU525_RS06580 (KU525_06560) | - | 1368256..1368687 (-) | 432 | WP_000455861.1 | CHAP domain-containing protein | - |
| KU525_RS06585 (KU525_06565) | - | 1369077..1369295 (-) | 219 | WP_000011686.1 | sterile alpha motif-like domain-containing protein | - |
| KU525_RS06590 (KU525_06570) | cidR | 1369462..1370340 (+) | 879 | WP_000351761.1 | cidABC operon transcriptional activator CidR | - |
| KU525_RS06595 (KU525_06575) | cidA | 1370553..1370948 (+) | 396 | WP_000549734.1 | holin-like murein hydrolase modulator CidA | - |
| KU525_RS06600 (KU525_06580) | - | 1370941..1371630 (+) | 690 | WP_001001019.1 | LrgB family protein | - |
| KU525_RS06605 (KU525_06585) | - | 1371677..1371955 (+) | 279 | Protein_1298 | thiamine pyrophosphate-binding protein | - |
| KU525_RS06610 (KU525_06590) | - | 1372016..1373053 (-) | 1038 | WP_000857191.1 | tyrosine-type recombinase/integrase | - |
| KU525_RS06615 (KU525_06595) | - | 1373112..1373576 (-) | 465 | WP_000825947.1 | hypothetical protein | - |
| KU525_RS06620 (KU525_06600) | - | 1373676..1373858 (-) | 183 | WP_000705248.1 | hypothetical protein | - |
| KU525_RS06625 (KU525_06605) | - | 1374062..1374403 (-) | 342 | WP_000591749.1 | hypothetical protein | - |
| KU525_RS06630 (KU525_06610) | - | 1374409..1375341 (-) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| KU525_RS06635 (KU525_06615) | - | 1375357..1376070 (-) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| KU525_RS06640 (KU525_06620) | - | 1376033..1376206 (+) | 174 | WP_001801500.1 | hypothetical protein | - |
| KU525_RS06645 (KU525_06625) | - | 1376203..1376466 (+) | 264 | WP_000854073.1 | helix-turn-helix transcriptional regulator | - |
| KU525_RS06650 (KU525_06630) | - | 1376482..1376697 (+) | 216 | WP_001025404.1 | MW1434 family type I TA system toxin | - |
| KU525_RS06655 (KU525_06635) | - | 1376686..1377015 (-) | 330 | WP_000128907.1 | hypothetical protein | - |
| KU525_RS06660 (KU525_06640) | - | 1377066..1377818 (+) | 753 | WP_001148605.1 | phage antirepressor KilAC domain-containing protein | - |
| KU525_RS06665 (KU525_06645) | - | 1377834..1378031 (+) | 198 | WP_001148862.1 | hypothetical protein | - |
| KU525_RS06670 (KU525_06650) | - | 1378018..1378398 (-) | 381 | WP_000762519.1 | DUF2513 domain-containing protein | - |
| KU525_RS06675 (KU525_06655) | - | 1378453..1378776 (+) | 324 | WP_001120201.1 | DUF771 domain-containing protein | - |
| KU525_RS06680 (KU525_06660) | - | 1378773..1378934 (+) | 162 | WP_000048129.1 | DUF1270 family protein | - |
| KU525_RS06685 (KU525_06665) | - | 1379029..1379331 (+) | 303 | WP_000165371.1 | DUF2482 family protein | - |
| KU525_RS06690 (KU525_06670) | - | 1379336..1379596 (+) | 261 | WP_000291510.1 | DUF1108 family protein | - |
| KU525_RS06695 (KU525_06675) | - | 1379605..1379868 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| KU525_RS06700 (KU525_06680) | - | 1379877..1381820 (+) | 1944 | WP_000700555.1 | AAA family ATPase | - |
| KU525_RS06705 (KU525_06685) | - | 1381822..1382742 (+) | 921 | WP_000138475.1 | recombinase RecT | - |
| KU525_RS06710 (KU525_06690) | - | 1382823..1383440 (+) | 618 | WP_073394849.1 | MBL fold metallo-hydrolase | - |
| KU525_RS06715 (KU525_06695) | ssbA | 1383441..1383911 (+) | 471 | WP_000610648.1 | single-stranded DNA-binding protein | Machinery gene |
| KU525_RS06720 (KU525_06700) | - | 1383941..1384834 (+) | 894 | WP_000148321.1 | DnaD domain protein | - |
| KU525_RS06725 (KU525_06705) | - | 1384841..1385059 (+) | 219 | WP_000338530.1 | hypothetical protein | - |
| KU525_RS06730 (KU525_06710) | - | 1385068..1385472 (+) | 405 | WP_000401960.1 | RusA family crossover junction endodeoxyribonuclease | - |
| KU525_RS06735 (KU525_06715) | - | 1385485..1385853 (+) | 369 | WP_000101288.1 | SA1788 family PVL leukocidin-associated protein | - |
| KU525_RS06740 (KU525_06720) | - | 1385857..1386099 (+) | 243 | WP_000131370.1 | SAV1978 family virulence-associated passenger protein | - |
| KU525_RS06745 (KU525_06725) | - | 1386114..1386368 (+) | 255 | WP_001065097.1 | DUF1024 family protein | - |
| KU525_RS06750 (KU525_06730) | - | 1386355..1386525 (+) | 171 | WP_000714403.1 | hypothetical protein | - |
| KU525_RS06755 (KU525_06735) | - | 1386518..1387054 (+) | 537 | WP_001066447.1 | dUTP diphosphatase | - |
| KU525_RS06760 (KU525_06740) | - | 1387091..1387336 (+) | 246 | WP_001282074.1 | hypothetical protein | - |
| KU525_RS06765 (KU525_06745) | - | 1387333..1387539 (+) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| KU525_RS06770 (KU525_06750) | - | 1387536..1387922 (+) | 387 | WP_000592207.1 | hypothetical protein | - |
| KU525_RS06775 (KU525_06755) | rinB | 1387919..1388068 (+) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| KU525_RS06780 (KU525_06760) | - | 1388068..1388268 (+) | 201 | WP_001622114.1 | DUF1514 family protein | - |
| KU525_RS06785 (KU525_06765) | - | 1388296..1388712 (+) | 417 | WP_000590122.1 | hypothetical protein | - |
| KU525_RS06790 (KU525_06770) | - | 1388944..1389243 (+) | 300 | WP_000988336.1 | HNH endonuclease | - |
| KU525_RS06795 (KU525_06775) | - | 1389374..1389718 (+) | 345 | WP_000402904.1 | hypothetical protein | - |
| KU525_RS06800 (KU525_06780) | - | 1389715..1391376 (+) | 1662 | WP_000625088.1 | terminase large subunit | - |
| KU525_RS06805 (KU525_06785) | - | 1391392..1392579 (+) | 1188 | WP_000025274.1 | phage portal protein | - |
| KU525_RS06810 (KU525_06790) | - | 1392563..1393300 (+) | 738 | WP_000642728.1 | head maturation protease, ClpP-related | - |
| KU525_RS06815 (KU525_06795) | - | 1393324..1394469 (+) | 1146 | WP_000154559.1 | phage major capsid protein | - |
| KU525_RS06820 (KU525_06800) | - | 1394489..1394773 (+) | 285 | WP_000238236.1 | hypothetical protein | - |
| KU525_RS06825 (KU525_06805) | - | 1394763..1395047 (+) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| KU525_RS06830 (KU525_06810) | - | 1395031..1395393 (+) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| KU525_RS06835 (KU525_06815) | - | 1395390..1395794 (+) | 405 | WP_000114227.1 | HK97 gp10 family phage protein | - |
| KU525_RS06840 (KU525_06820) | - | 1395791..1396198 (+) | 408 | WP_000565498.1 | hypothetical protein | - |
| KU525_RS06845 (KU525_06825) | - | 1396199..1396843 (+) | 645 | WP_000268733.1 | major tail protein | - |
| KU525_RS06850 (KU525_06830) | - | 1396897..1397109 (+) | 213 | WP_078101489.1 | Ig-like domain-containing protein | - |
| KU525_RS06855 (KU525_06835) | gpG | 1397159..1397509 (+) | 351 | WP_001096355.1 | phage tail assembly chaperone G | - |
| KU525_RS06860 (KU525_06840) | gpGT | 1397560..1397697 (+) | 138 | WP_001549167.1 | phage tail assembly chaperone GT | - |
| KU525_RS06865 (KU525_06845) | - | 1397754..1402283 (+) | 4530 | WP_001796452.1 | phage tail tape measure protein | - |
| KU525_RS06870 (KU525_06850) | - | 1402280..1403764 (+) | 1485 | WP_000567408.1 | phage distal tail protein | - |
| KU525_RS06875 (KU525_06855) | - | 1403780..1407565 (+) | 3786 | WP_000582165.1 | phage tail spike protein | - |
| KU525_RS06880 (KU525_06860) | - | 1407555..1407707 (+) | 153 | WP_001153681.1 | hypothetical protein | - |
| KU525_RS06885 (KU525_06865) | - | 1407754..1408041 (+) | 288 | WP_001040261.1 | hypothetical protein | - |
| KU525_RS06890 (KU525_06870) | - | 1408099..1408395 (+) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| KU525_RS06895 (KU525_06875) | pepG1 | 1408587..1408721 (+) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| KU525_RS06900 (KU525_06880) | - | 1408774..1408881 (-) | 108 | WP_001791821.1 | hypothetical protein | - |
| KU525_RS06905 (KU525_06885) | - | 1408933..1409187 (+) | 255 | WP_000611512.1 | phage holin | - |
| KU525_RS06910 (KU525_06890) | - | 1409199..1409954 (+) | 756 | WP_064131634.1 | CHAP domain-containing protein | - |
| KU525_RS06915 (KU525_06895) | sak | 1410145..1410636 (+) | 492 | WP_000919350.1 | staphylokinase | - |
| KU525_RS06920 (KU525_06900) | - | 1411283..1411621 (+) | 339 | Protein_1361 | SH3 domain-containing protein | - |
| KU525_RS06925 (KU525_06905) | - | 1411716..1412165 (-) | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| KU525_RS06930 (KU525_06910) | scn | 1412850..1413200 (+) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17641.52 Da Isoelectric Point: 5.2672
>NTDB_id=585117 KU525_RS06715 WP_000610648.1 1383441..1383911(+) (ssbA) [Staphylococcus aureus strain 277]
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=585117 KU525_RS06715 WP_000610648.1 1383441..1383911(+) (ssbA) [Staphylococcus aureus strain 277]
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.558 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |