Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | KU509_RS05220 | Genome accession | NZ_CP077917 |
| Coordinates | 1009009..1009479 (-) | Length | 156 a.a. |
| NCBI ID | WP_000610648.1 | Uniprot ID | A0A090M1W2 |
| Organism | Staphylococcus aureus strain 280 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 979720..1021243 | 1009009..1009479 | within | 0 |
Gene organization within MGE regions
Location: 979720..1021243
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KU509_RS05005 (KU509_05060) | scn | 979720..980070 (-) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| KU509_RS05010 (KU509_05065) | - | 980755..981204 (+) | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| KU509_RS05015 (KU509_05070) | - | 981299..981637 (-) | 339 | Protein_951 | SH3 domain-containing protein | - |
| KU509_RS05020 (KU509_05075) | sak | 982284..982775 (-) | 492 | WP_000919350.1 | staphylokinase | - |
| KU509_RS05025 (KU509_05080) | - | 982966..983721 (-) | 756 | WP_064131634.1 | CHAP domain-containing protein | - |
| KU509_RS05030 (KU509_05085) | - | 983733..983987 (-) | 255 | WP_000611512.1 | phage holin | - |
| KU509_RS05035 (KU509_05090) | - | 984039..984146 (+) | 108 | WP_001791821.1 | hypothetical protein | - |
| KU509_RS05040 (KU509_05095) | pepG1 | 984199..984333 (-) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| KU509_RS05045 (KU509_05100) | - | 984525..984821 (-) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| KU509_RS05050 (KU509_05105) | - | 984879..985166 (-) | 288 | WP_001040261.1 | hypothetical protein | - |
| KU509_RS05055 (KU509_05110) | - | 985213..985365 (-) | 153 | WP_001153681.1 | hypothetical protein | - |
| KU509_RS05060 (KU509_05115) | - | 985355..989140 (-) | 3786 | WP_000582165.1 | phage tail spike protein | - |
| KU509_RS05065 (KU509_05120) | - | 989156..990640 (-) | 1485 | WP_000567408.1 | phage distal tail protein | - |
| KU509_RS05070 (KU509_05125) | - | 990637..995166 (-) | 4530 | WP_001796452.1 | phage tail tape measure protein | - |
| KU509_RS05075 (KU509_05130) | gpGT | 995223..995360 (-) | 138 | WP_001549167.1 | phage tail assembly chaperone GT | - |
| KU509_RS05080 (KU509_05135) | gpG | 995411..995761 (-) | 351 | WP_001096355.1 | phage tail assembly chaperone G | - |
| KU509_RS05085 (KU509_05140) | - | 995811..996035 (-) | 225 | WP_071621395.1 | Ig-like domain-containing protein | - |
| KU509_RS05090 (KU509_05145) | - | 996077..996721 (-) | 645 | WP_000268733.1 | major tail protein | - |
| KU509_RS05095 (KU509_05150) | - | 996722..997129 (-) | 408 | WP_000565498.1 | hypothetical protein | - |
| KU509_RS05100 (KU509_05155) | - | 997126..997530 (-) | 405 | WP_000114227.1 | HK97 gp10 family phage protein | - |
| KU509_RS05105 (KU509_05160) | - | 997527..997889 (-) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| KU509_RS05110 (KU509_05165) | - | 997873..998157 (-) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| KU509_RS05115 (KU509_05170) | - | 998147..998431 (-) | 285 | WP_000238236.1 | hypothetical protein | - |
| KU509_RS05120 (KU509_05175) | - | 998451..999596 (-) | 1146 | WP_000154559.1 | phage major capsid protein | - |
| KU509_RS05125 (KU509_05180) | - | 999620..1000357 (-) | 738 | WP_000642728.1 | head maturation protease, ClpP-related | - |
| KU509_RS05130 (KU509_05185) | - | 1000341..1001528 (-) | 1188 | WP_000025274.1 | phage portal protein | - |
| KU509_RS05135 (KU509_05190) | - | 1001544..1003205 (-) | 1662 | WP_000625088.1 | terminase large subunit | - |
| KU509_RS05140 (KU509_05195) | - | 1003202..1003546 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| KU509_RS05145 (KU509_05200) | - | 1003677..1003976 (-) | 300 | WP_000988336.1 | HNH endonuclease | - |
| KU509_RS05150 (KU509_05205) | - | 1004208..1004624 (-) | 417 | WP_000590122.1 | hypothetical protein | - |
| KU509_RS05155 (KU509_05210) | - | 1004652..1004852 (-) | 201 | WP_001622114.1 | DUF1514 family protein | - |
| KU509_RS05160 (KU509_05215) | rinB | 1004852..1005001 (-) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| KU509_RS05165 (KU509_05220) | - | 1004998..1005384 (-) | 387 | WP_000592207.1 | hypothetical protein | - |
| KU509_RS05170 (KU509_05225) | - | 1005381..1005587 (-) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| KU509_RS05175 (KU509_05230) | - | 1005584..1005829 (-) | 246 | WP_001282074.1 | hypothetical protein | - |
| KU509_RS05180 (KU509_05235) | - | 1005866..1006402 (-) | 537 | WP_001066447.1 | dUTP diphosphatase | - |
| KU509_RS05185 (KU509_05240) | - | 1006395..1006565 (-) | 171 | WP_000714403.1 | hypothetical protein | - |
| KU509_RS05190 (KU509_05245) | - | 1006552..1006806 (-) | 255 | WP_001065097.1 | DUF1024 family protein | - |
| KU509_RS05195 (KU509_05250) | - | 1006821..1007063 (-) | 243 | WP_000131370.1 | SAV1978 family virulence-associated passenger protein | - |
| KU509_RS05200 (KU509_05255) | - | 1007067..1007435 (-) | 369 | WP_000101288.1 | SA1788 family PVL leukocidin-associated protein | - |
| KU509_RS05205 (KU509_05260) | - | 1007448..1007852 (-) | 405 | WP_000401960.1 | RusA family crossover junction endodeoxyribonuclease | - |
| KU509_RS05210 (KU509_05265) | - | 1007861..1008079 (-) | 219 | WP_000338530.1 | hypothetical protein | - |
| KU509_RS05215 (KU509_05270) | - | 1008086..1008979 (-) | 894 | WP_000148321.1 | DnaD domain protein | - |
| KU509_RS05220 (KU509_05275) | ssbA | 1009009..1009479 (-) | 471 | WP_000610648.1 | single-stranded DNA-binding protein | Machinery gene |
| KU509_RS05225 (KU509_05280) | - | 1009480..1010097 (-) | 618 | WP_073394849.1 | MBL fold metallo-hydrolase | - |
| KU509_RS05230 (KU509_05285) | - | 1010178..1011098 (-) | 921 | WP_000138475.1 | recombinase RecT | - |
| KU509_RS05235 (KU509_05290) | - | 1011100..1013043 (-) | 1944 | WP_000700555.1 | AAA family ATPase | - |
| KU509_RS05240 (KU509_05295) | - | 1013052..1013315 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| KU509_RS05245 (KU509_05300) | - | 1013324..1013584 (-) | 261 | WP_000291510.1 | DUF1108 family protein | - |
| KU509_RS05250 (KU509_05305) | - | 1013589..1013891 (-) | 303 | WP_000165371.1 | DUF2482 family protein | - |
| KU509_RS05255 (KU509_05310) | - | 1013986..1014147 (-) | 162 | WP_000048129.1 | DUF1270 family protein | - |
| KU509_RS05260 (KU509_05315) | - | 1014144..1014467 (-) | 324 | WP_001120201.1 | DUF771 domain-containing protein | - |
| KU509_RS05265 (KU509_05320) | - | 1014522..1014902 (+) | 381 | WP_000762519.1 | DUF2513 domain-containing protein | - |
| KU509_RS05270 (KU509_05325) | - | 1014889..1015086 (-) | 198 | WP_001148862.1 | hypothetical protein | - |
| KU509_RS05275 (KU509_05330) | - | 1015102..1015854 (-) | 753 | WP_001148605.1 | phage antirepressor KilAC domain-containing protein | - |
| KU509_RS05280 (KU509_05335) | - | 1015905..1016234 (+) | 330 | WP_000128907.1 | hypothetical protein | - |
| KU509_RS05285 (KU509_05340) | - | 1016223..1016438 (-) | 216 | WP_001025404.1 | MW1434 family type I TA system toxin | - |
| KU509_RS05290 (KU509_05345) | - | 1016454..1016717 (-) | 264 | WP_000854073.1 | helix-turn-helix transcriptional regulator | - |
| KU509_RS05295 (KU509_05350) | - | 1016714..1016887 (-) | 174 | WP_001801500.1 | hypothetical protein | - |
| KU509_RS05300 (KU509_05355) | - | 1016850..1017563 (+) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| KU509_RS05305 (KU509_05360) | - | 1017579..1018511 (+) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| KU509_RS05310 (KU509_05365) | - | 1018517..1018858 (+) | 342 | WP_000591749.1 | hypothetical protein | - |
| KU509_RS05315 (KU509_05370) | - | 1019062..1019244 (+) | 183 | WP_000705248.1 | hypothetical protein | - |
| KU509_RS05320 (KU509_05375) | - | 1019344..1019808 (+) | 465 | WP_000825947.1 | hypothetical protein | - |
| KU509_RS05325 (KU509_05380) | - | 1019867..1020904 (+) | 1038 | WP_000857191.1 | tyrosine-type recombinase/integrase | - |
| KU509_RS05330 (KU509_05385) | - | 1020965..1021243 (-) | 279 | Protein_1014 | thiamine pyrophosphate-binding protein | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17641.52 Da Isoelectric Point: 5.2672
>NTDB_id=585040 KU509_RS05220 WP_000610648.1 1009009..1009479(-) (ssbA) [Staphylococcus aureus strain 280]
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=585040 KU509_RS05220 WP_000610648.1 1009009..1009479(-) (ssbA) [Staphylococcus aureus strain 280]
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.558 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |