Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | KU503_RS09920 | Genome accession | NZ_CP077898 |
| Coordinates | 1978206..1978676 (-) | Length | 156 a.a. |
| NCBI ID | WP_000610648.1 | Uniprot ID | A0A090M1W2 |
| Organism | Staphylococcus aureus strain 327 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1948918..1999200 | 1978206..1978676 | within | 0 |
Gene organization within MGE regions
Location: 1948918..1999200
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KU503_RS09705 (KU503_09665) | scn | 1948918..1949268 (-) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| KU503_RS09710 (KU503_09670) | - | 1949953..1950402 (+) | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| KU503_RS09715 (KU503_09675) | - | 1950497..1950835 (-) | 339 | Protein_1882 | SH3 domain-containing protein | - |
| KU503_RS09720 (KU503_09680) | sak | 1951482..1951973 (-) | 492 | WP_000919350.1 | staphylokinase | - |
| KU503_RS09725 (KU503_09685) | - | 1952164..1952919 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| KU503_RS09730 (KU503_09690) | - | 1952931..1953185 (-) | 255 | WP_000611512.1 | phage holin | - |
| KU503_RS09735 (KU503_09695) | - | 1953237..1953344 (+) | 108 | WP_001791821.1 | hypothetical protein | - |
| KU503_RS09740 (KU503_09700) | pepG1 | 1953397..1953531 (-) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| KU503_RS09745 (KU503_09705) | - | 1953723..1954019 (-) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| KU503_RS09750 (KU503_09710) | - | 1954077..1954364 (-) | 288 | WP_001040261.1 | hypothetical protein | - |
| KU503_RS09755 (KU503_09715) | - | 1954411..1954563 (-) | 153 | WP_001153681.1 | hypothetical protein | - |
| KU503_RS09760 (KU503_09720) | - | 1954553..1958338 (-) | 3786 | WP_176330934.1 | phage tail spike protein | - |
| KU503_RS09765 (KU503_09725) | - | 1958354..1959838 (-) | 1485 | WP_000567408.1 | phage distal tail protein | - |
| KU503_RS09770 (KU503_09730) | - | 1959835..1964364 (-) | 4530 | WP_225806295.1 | phage tail tape measure protein | - |
| KU503_RS09775 (KU503_09735) | gpGT | 1964421..1964558 (-) | 138 | WP_001549167.1 | phage tail assembly chaperone GT | - |
| KU503_RS09780 (KU503_09740) | gpG | 1964609..1964959 (-) | 351 | WP_001096355.1 | phage tail assembly chaperone G | - |
| KU503_RS09785 (KU503_09745) | - | 1965009..1965233 (-) | 225 | WP_071621395.1 | Ig-like domain-containing protein | - |
| KU503_RS09790 (KU503_09750) | - | 1965275..1965919 (-) | 645 | WP_000268733.1 | major tail protein | - |
| KU503_RS09795 (KU503_09755) | - | 1965920..1966327 (-) | 408 | WP_000565498.1 | hypothetical protein | - |
| KU503_RS09800 (KU503_09760) | - | 1966324..1966728 (-) | 405 | WP_000114227.1 | HK97 gp10 family phage protein | - |
| KU503_RS09805 (KU503_09765) | - | 1966725..1967087 (-) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| KU503_RS09810 (KU503_09770) | - | 1967071..1967355 (-) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| KU503_RS09815 (KU503_09775) | - | 1967345..1967629 (-) | 285 | WP_000238236.1 | hypothetical protein | - |
| KU503_RS09820 (KU503_09780) | - | 1967649..1968794 (-) | 1146 | WP_000154559.1 | phage major capsid protein | - |
| KU503_RS09825 (KU503_09785) | - | 1968818..1969555 (-) | 738 | WP_225806294.1 | head maturation protease, ClpP-related | - |
| KU503_RS09830 (KU503_09790) | - | 1969539..1970726 (-) | 1188 | WP_000025274.1 | phage portal protein | - |
| KU503_RS09835 (KU503_09795) | - | 1970742..1972403 (-) | 1662 | WP_000625088.1 | terminase large subunit | - |
| KU503_RS09840 (KU503_09800) | - | 1972400..1972744 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| KU503_RS09845 (KU503_09805) | - | 1972874..1973173 (-) | 300 | WP_000988336.1 | HNH endonuclease | - |
| KU503_RS09850 (KU503_09810) | - | 1973405..1973821 (-) | 417 | WP_000590122.1 | hypothetical protein | - |
| KU503_RS09855 (KU503_09815) | - | 1973849..1974049 (-) | 201 | WP_001622114.1 | DUF1514 family protein | - |
| KU503_RS09860 (KU503_09820) | rinB | 1974049..1974198 (-) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| KU503_RS09865 (KU503_09825) | - | 1974195..1974581 (-) | 387 | WP_000592207.1 | hypothetical protein | - |
| KU503_RS09870 (KU503_09830) | - | 1974578..1974784 (-) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| KU503_RS09875 (KU503_09835) | - | 1974781..1975026 (-) | 246 | WP_001282074.1 | hypothetical protein | - |
| KU503_RS09880 (KU503_09840) | - | 1975063..1975599 (-) | 537 | WP_001066447.1 | dUTP diphosphatase | - |
| KU503_RS09885 (KU503_09845) | - | 1975592..1975762 (-) | 171 | WP_000714403.1 | hypothetical protein | - |
| KU503_RS09890 (KU503_09850) | - | 1975749..1976003 (-) | 255 | WP_001065097.1 | DUF1024 family protein | - |
| KU503_RS09895 (KU503_09855) | - | 1976018..1976260 (-) | 243 | WP_000131370.1 | SAV1978 family virulence-associated passenger protein | - |
| KU503_RS09900 (KU503_09860) | - | 1976264..1976632 (-) | 369 | WP_000101288.1 | SA1788 family PVL leukocidin-associated protein | - |
| KU503_RS09905 (KU503_09865) | - | 1976645..1977049 (-) | 405 | WP_061104778.1 | RusA family crossover junction endodeoxyribonuclease | - |
| KU503_RS09910 (KU503_09870) | - | 1977058..1977276 (-) | 219 | WP_000338530.1 | hypothetical protein | - |
| KU503_RS09915 (KU503_09875) | - | 1977283..1978176 (-) | 894 | WP_000148321.1 | DnaD domain protein | - |
| KU503_RS09920 (KU503_09880) | ssbA | 1978206..1978676 (-) | 471 | WP_000610648.1 | single-stranded DNA-binding protein | Machinery gene |
| KU503_RS09925 (KU503_09885) | - | 1978677..1979294 (-) | 618 | WP_073394849.1 | MBL fold metallo-hydrolase | - |
| KU503_RS09930 (KU503_09890) | - | 1979375..1980295 (-) | 921 | WP_000138475.1 | recombinase RecT | - |
| KU503_RS09935 (KU503_09895) | - | 1980297..1982240 (-) | 1944 | WP_000700555.1 | AAA family ATPase | - |
| KU503_RS09940 (KU503_09900) | - | 1982249..1982512 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| KU503_RS09945 (KU503_09905) | - | 1982521..1982781 (-) | 261 | WP_000291510.1 | DUF1108 family protein | - |
| KU503_RS09950 (KU503_09910) | - | 1982786..1983088 (-) | 303 | WP_000165371.1 | DUF2482 family protein | - |
| KU503_RS09955 (KU503_09915) | - | 1983183..1983344 (-) | 162 | WP_000048129.1 | DUF1270 family protein | - |
| KU503_RS09960 (KU503_09920) | - | 1983341..1983664 (-) | 324 | WP_001120201.1 | DUF771 domain-containing protein | - |
| KU503_RS09965 (KU503_09925) | - | 1983719..1984099 (+) | 381 | WP_000762519.1 | DUF2513 domain-containing protein | - |
| KU503_RS09970 (KU503_09930) | - | 1984086..1984283 (-) | 198 | WP_001148862.1 | hypothetical protein | - |
| KU503_RS09975 (KU503_09935) | - | 1984299..1985051 (-) | 753 | WP_001148605.1 | phage antirepressor KilAC domain-containing protein | - |
| KU503_RS09980 (KU503_09940) | - | 1985102..1985431 (+) | 330 | WP_000128907.1 | hypothetical protein | - |
| KU503_RS09985 (KU503_09945) | - | 1985420..1985635 (-) | 216 | WP_001025404.1 | MW1434 family type I TA system toxin | - |
| KU503_RS09990 (KU503_09950) | - | 1985651..1985914 (-) | 264 | WP_000854073.1 | helix-turn-helix transcriptional regulator | - |
| KU503_RS09995 (KU503_09955) | - | 1985911..1986084 (-) | 174 | WP_001801500.1 | hypothetical protein | - |
| KU503_RS10000 (KU503_09960) | - | 1986047..1986760 (+) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| KU503_RS10005 (KU503_09965) | - | 1986776..1987708 (+) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| KU503_RS10010 (KU503_09970) | - | 1987714..1988055 (+) | 342 | WP_000591749.1 | hypothetical protein | - |
| KU503_RS10015 (KU503_09975) | - | 1988259..1988441 (+) | 183 | WP_000705248.1 | hypothetical protein | - |
| KU503_RS10020 (KU503_09980) | - | 1988541..1989005 (+) | 465 | WP_225806293.1 | hypothetical protein | - |
| KU503_RS10025 (KU503_09985) | - | 1989064..1990101 (+) | 1038 | WP_000857191.1 | tyrosine-type recombinase/integrase | - |
| KU503_RS10030 (KU503_09990) | sph | 1990158..1990982 (+) | 825 | Protein_1945 | sphingomyelin phosphodiesterase | - |
| KU503_RS10035 (KU503_09995) | - | 1991239..1992258 (-) | 1020 | WP_000595616.1 | leukocidin/hemolysin toxin family protein | - |
| KU503_RS10040 (KU503_10000) | - | 1992280..1993335 (-) | 1056 | WP_000791399.1 | leukocidin family pore-forming toxin | - |
| KU503_RS10045 (KU503_10005) | - | 1993766..1994989 (+) | 1224 | WP_000206615.1 | ArgE/DapE family deacylase | - |
| KU503_RS10050 (KU503_10010) | - | 1995385..1996692 (+) | 1308 | WP_001045070.1 | TrkH family potassium uptake protein | - |
| KU503_RS10055 (KU503_10015) | groL | 1997224..1998840 (-) | 1617 | WP_000240642.1 | chaperonin GroEL | - |
| KU503_RS10060 (KU503_10020) | groES | 1998916..1999200 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17641.52 Da Isoelectric Point: 5.2672
>NTDB_id=584796 KU503_RS09920 WP_000610648.1 1978206..1978676(-) (ssbA) [Staphylococcus aureus strain 327]
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=584796 KU503_RS09920 WP_000610648.1 1978206..1978676(-) (ssbA) [Staphylococcus aureus strain 327]
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.558 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |