Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | KU544_RS09585 | Genome accession | NZ_CP077897 |
| Coordinates | 1928531..1929001 (+) | Length | 156 a.a. |
| NCBI ID | WP_000610648.1 | Uniprot ID | A0A090M1W2 |
| Organism | Staphylococcus aureus strain 328 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1905036..1958289 | 1928531..1929001 | within | 0 |
Gene organization within MGE regions
Location: 1905036..1958289
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KU544_RS09430 (KU544_09405) | - | 1905036..1905662 (-) | 627 | WP_000522375.1 | nitroreductase family protein | - |
| KU544_RS09435 (KU544_09410) | - | 1905859..1907064 (+) | 1206 | WP_000120327.1 | SdrH family protein | - |
| KU544_RS09440 (KU544_09415) | mroQ | 1907089..1907832 (-) | 744 | WP_000197627.1 | CPBP family intramembrane glutamic endopeptidase MroQ | - |
| KU544_RS09445 (KU544_09420) | groES | 1908007..1908291 (+) | 285 | WP_000917289.1 | co-chaperone GroES | - |
| KU544_RS09450 (KU544_09425) | groL | 1908367..1909983 (+) | 1617 | WP_000240642.1 | chaperonin GroEL | - |
| KU544_RS09455 (KU544_09430) | - | 1910515..1911822 (-) | 1308 | WP_001045070.1 | TrkH family potassium uptake protein | - |
| KU544_RS09460 (KU544_09435) | - | 1912218..1913441 (-) | 1224 | WP_000206615.1 | ArgE/DapE family deacylase | - |
| KU544_RS09465 (KU544_09440) | - | 1913872..1914927 (+) | 1056 | WP_000791399.1 | leukocidin family pore-forming toxin | - |
| KU544_RS09470 (KU544_09445) | - | 1914949..1915968 (+) | 1020 | WP_000595616.1 | leukocidin/hemolysin toxin family protein | - |
| KU544_RS09475 (KU544_09450) | sph | 1916225..1917049 (-) | 825 | Protein_1860 | sphingomyelin phosphodiesterase | - |
| KU544_RS09480 (KU544_09455) | - | 1917106..1918143 (-) | 1038 | WP_000857191.1 | tyrosine-type recombinase/integrase | - |
| KU544_RS09485 (KU544_09460) | - | 1918202..1918666 (-) | 465 | WP_225806293.1 | hypothetical protein | - |
| KU544_RS09490 (KU544_09465) | - | 1918766..1918948 (-) | 183 | WP_000705248.1 | hypothetical protein | - |
| KU544_RS09495 (KU544_09470) | - | 1919152..1919493 (-) | 342 | WP_000591749.1 | hypothetical protein | - |
| KU544_RS09500 (KU544_09475) | - | 1919499..1920431 (-) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| KU544_RS09505 (KU544_09480) | - | 1920447..1921160 (-) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| KU544_RS09510 (KU544_09485) | - | 1921123..1921296 (+) | 174 | WP_001801500.1 | hypothetical protein | - |
| KU544_RS09515 (KU544_09490) | - | 1921293..1921556 (+) | 264 | WP_000854073.1 | helix-turn-helix transcriptional regulator | - |
| KU544_RS09520 (KU544_09495) | - | 1921572..1921787 (+) | 216 | WP_001025404.1 | MW1434 family type I TA system toxin | - |
| KU544_RS09525 (KU544_09500) | - | 1921776..1922105 (-) | 330 | WP_000128907.1 | hypothetical protein | - |
| KU544_RS09530 (KU544_09505) | - | 1922156..1922908 (+) | 753 | WP_001148605.1 | phage antirepressor KilAC domain-containing protein | - |
| KU544_RS09535 (KU544_09510) | - | 1922924..1923121 (+) | 198 | WP_001148862.1 | hypothetical protein | - |
| KU544_RS09540 (KU544_09515) | - | 1923108..1923488 (-) | 381 | WP_000762519.1 | DUF2513 domain-containing protein | - |
| KU544_RS09545 (KU544_09520) | - | 1923543..1923866 (+) | 324 | WP_001120201.1 | DUF771 domain-containing protein | - |
| KU544_RS09550 (KU544_09525) | - | 1923863..1924024 (+) | 162 | WP_000048129.1 | DUF1270 family protein | - |
| KU544_RS09555 (KU544_09530) | - | 1924119..1924421 (+) | 303 | WP_000165371.1 | DUF2482 family protein | - |
| KU544_RS09560 (KU544_09535) | - | 1924426..1924686 (+) | 261 | WP_000291510.1 | DUF1108 family protein | - |
| KU544_RS09565 (KU544_09540) | - | 1924695..1924958 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| KU544_RS09570 (KU544_09545) | - | 1924967..1926910 (+) | 1944 | WP_000700555.1 | AAA family ATPase | - |
| KU544_RS09575 (KU544_09550) | - | 1926912..1927832 (+) | 921 | WP_000138475.1 | recombinase RecT | - |
| KU544_RS09580 (KU544_09555) | - | 1927913..1928530 (+) | 618 | WP_073394849.1 | MBL fold metallo-hydrolase | - |
| KU544_RS09585 (KU544_09560) | ssbA | 1928531..1929001 (+) | 471 | WP_000610648.1 | single-stranded DNA-binding protein | Machinery gene |
| KU544_RS09590 (KU544_09565) | - | 1929031..1929924 (+) | 894 | WP_000148321.1 | DnaD domain protein | - |
| KU544_RS09595 (KU544_09570) | - | 1929931..1930149 (+) | 219 | WP_000338530.1 | hypothetical protein | - |
| KU544_RS09600 (KU544_09575) | - | 1930158..1930562 (+) | 405 | WP_061104778.1 | RusA family crossover junction endodeoxyribonuclease | - |
| KU544_RS09605 (KU544_09580) | - | 1930575..1930943 (+) | 369 | WP_000101288.1 | SA1788 family PVL leukocidin-associated protein | - |
| KU544_RS09610 (KU544_09585) | - | 1930947..1931189 (+) | 243 | WP_000131370.1 | SAV1978 family virulence-associated passenger protein | - |
| KU544_RS09615 (KU544_09590) | - | 1931204..1931458 (+) | 255 | WP_001065097.1 | DUF1024 family protein | - |
| KU544_RS09620 (KU544_09595) | - | 1931445..1931615 (+) | 171 | WP_000714403.1 | hypothetical protein | - |
| KU544_RS09625 (KU544_09600) | - | 1931608..1932144 (+) | 537 | WP_001066447.1 | dUTP diphosphatase | - |
| KU544_RS09630 (KU544_09605) | - | 1932181..1932426 (+) | 246 | WP_001282074.1 | hypothetical protein | - |
| KU544_RS09635 (KU544_09610) | - | 1932423..1932629 (+) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| KU544_RS09640 (KU544_09615) | - | 1932626..1933012 (+) | 387 | WP_000592207.1 | hypothetical protein | - |
| KU544_RS09645 (KU544_09620) | rinB | 1933009..1933158 (+) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| KU544_RS09650 (KU544_09625) | - | 1933158..1933358 (+) | 201 | WP_001622114.1 | DUF1514 family protein | - |
| KU544_RS09655 (KU544_09630) | - | 1933386..1933802 (+) | 417 | WP_000590122.1 | hypothetical protein | - |
| KU544_RS09660 (KU544_09635) | - | 1934034..1934333 (+) | 300 | WP_000988336.1 | HNH endonuclease | - |
| KU544_RS09665 (KU544_09640) | - | 1934463..1934807 (+) | 345 | WP_000402904.1 | hypothetical protein | - |
| KU544_RS09670 (KU544_09645) | - | 1934804..1936465 (+) | 1662 | WP_000625088.1 | terminase large subunit | - |
| KU544_RS09675 (KU544_09650) | - | 1936481..1937668 (+) | 1188 | WP_000025274.1 | phage portal protein | - |
| KU544_RS09680 (KU544_09655) | - | 1937652..1938389 (+) | 738 | WP_225806294.1 | head maturation protease, ClpP-related | - |
| KU544_RS09685 (KU544_09660) | - | 1938413..1939558 (+) | 1146 | WP_000154559.1 | phage major capsid protein | - |
| KU544_RS09690 (KU544_09665) | - | 1939578..1939862 (+) | 285 | WP_000238236.1 | hypothetical protein | - |
| KU544_RS09695 (KU544_09670) | - | 1939852..1940136 (+) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| KU544_RS09700 (KU544_09675) | - | 1940120..1940482 (+) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| KU544_RS09705 (KU544_09680) | - | 1940479..1940883 (+) | 405 | WP_000114227.1 | HK97 gp10 family phage protein | - |
| KU544_RS09710 (KU544_09685) | - | 1940880..1941287 (+) | 408 | WP_000565498.1 | hypothetical protein | - |
| KU544_RS09715 (KU544_09690) | - | 1941288..1941932 (+) | 645 | WP_000268733.1 | major tail protein | - |
| KU544_RS09720 (KU544_09695) | - | 1941986..1942198 (+) | 213 | WP_078101489.1 | Ig-like domain-containing protein | - |
| KU544_RS09725 (KU544_09700) | gpG | 1942248..1942598 (+) | 351 | WP_001096355.1 | phage tail assembly chaperone G | - |
| KU544_RS09730 (KU544_09705) | gpGT | 1942649..1942786 (+) | 138 | WP_001549167.1 | phage tail assembly chaperone GT | - |
| KU544_RS09735 (KU544_09710) | - | 1942843..1947372 (+) | 4530 | WP_225806295.1 | phage tail tape measure protein | - |
| KU544_RS09740 (KU544_09715) | - | 1947369..1948853 (+) | 1485 | WP_000567408.1 | phage distal tail protein | - |
| KU544_RS09745 (KU544_09720) | - | 1948869..1952654 (+) | 3786 | WP_176330934.1 | phage tail spike protein | - |
| KU544_RS09750 (KU544_09725) | - | 1952644..1952796 (+) | 153 | WP_001153681.1 | hypothetical protein | - |
| KU544_RS09755 (KU544_09730) | - | 1952843..1953130 (+) | 288 | WP_001040261.1 | hypothetical protein | - |
| KU544_RS09760 (KU544_09735) | - | 1953188..1953484 (+) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| KU544_RS09765 (KU544_09740) | pepG1 | 1953676..1953810 (+) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| KU544_RS09770 (KU544_09745) | - | 1953863..1953970 (-) | 108 | WP_001791821.1 | hypothetical protein | - |
| KU544_RS09775 (KU544_09750) | - | 1954022..1954276 (+) | 255 | WP_000611512.1 | phage holin | - |
| KU544_RS09780 (KU544_09755) | - | 1954288..1955043 (+) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| KU544_RS09785 (KU544_09760) | sak | 1955234..1955725 (+) | 492 | WP_000919350.1 | staphylokinase | - |
| KU544_RS09790 (KU544_09765) | - | 1956372..1956710 (+) | 339 | Protein_1923 | SH3 domain-containing protein | - |
| KU544_RS09795 (KU544_09770) | - | 1956805..1957254 (-) | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| KU544_RS09800 (KU544_09775) | scn | 1957939..1958289 (+) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17641.52 Da Isoelectric Point: 5.2672
>NTDB_id=584738 KU544_RS09585 WP_000610648.1 1928531..1929001(+) (ssbA) [Staphylococcus aureus strain 328]
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=584738 KU544_RS09585 WP_000610648.1 1928531..1929001(+) (ssbA) [Staphylococcus aureus strain 328]
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.558 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |