Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   KU497_RS08515 Genome accession   NZ_CP077880
Coordinates   1674210..1674680 (-) Length   156 a.a.
NCBI ID   WP_000934770.1    Uniprot ID   -
Organism   Staphylococcus aureus strain 356     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1642993..1687693 1674210..1674680 within 0


Gene organization within MGE regions


Location: 1642993..1687693
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KU497_RS08290 (KU497_08280) - 1642993..1643550 (-) 558 WP_000528632.1 PBECR4 domain-containing protein -
  KU497_RS08295 (KU497_08285) - 1644186..1644371 (-) 186 WP_001286805.1 hypothetical protein -
  KU497_RS08300 (KU497_08290) - 1644373..1644483 (-) 111 WP_000139423.1 hypothetical protein -
  KU497_RS08305 (KU497_08295) - 1644554..1644706 (-) 153 WP_001788502.1 hypothetical protein -
  KU497_RS08310 (KU497_08300) - 1644951..1645289 (-) 339 Protein_1604 SH3 domain-containing protein -
  KU497_RS08315 (KU497_08305) sak 1645937..1646428 (-) 492 WP_000920038.1 staphylokinase -
  KU497_RS08320 (KU497_08310) - 1646619..1647374 (-) 756 WP_000861038.1 CHAP domain-containing protein -
  KU497_RS08325 (KU497_08315) - 1647386..1647640 (-) 255 WP_000611512.1 phage holin -
  KU497_RS08330 (KU497_08320) - 1647692..1647799 (+) 108 WP_031762631.1 hypothetical protein -
  KU497_RS08335 (KU497_08325) pepG1 1647852..1647986 (-) 135 WP_000226108.1 type I toxin-antitoxin system toxin PepG1 -
  KU497_RS08340 (KU497_08330) sea 1648137..1648910 (-) 774 WP_000750412.1 staphylococcal enterotoxin type A -
  KU497_RS08345 (KU497_08335) - 1649283..1649657 (-) 375 WP_000340977.1 hypothetical protein -
  KU497_RS08350 (KU497_08340) - 1649713..1650000 (-) 288 WP_001262621.1 hypothetical protein -
  KU497_RS08355 (KU497_08345) - 1650046..1650198 (-) 153 WP_001000058.1 hypothetical protein -
  KU497_RS08360 (KU497_08350) - 1650191..1653973 (-) 3783 WP_050956529.1 phage tail spike protein -
  KU497_RS08365 (KU497_08355) - 1653989..1655473 (-) 1485 WP_000567408.1 phage distal tail protein -
  KU497_RS08370 (KU497_08360) - 1655470..1659999 (-) 4530 WP_225806135.1 phage tail tape measure protein -
  KU497_RS08375 (KU497_08365) gpGT 1660056..1660193 (-) 138 WP_001549167.1 phage tail assembly chaperone GT -
  KU497_RS08380 (KU497_08370) gpG 1660244..1660594 (-) 351 WP_001096355.1 phage tail assembly chaperone G -
  KU497_RS08385 (KU497_08375) - 1660644..1660868 (-) 225 WP_072050172.1 Ig-like domain-containing protein -
  KU497_RS08390 (KU497_08380) - 1660910..1661554 (-) 645 WP_000268741.1 major tail protein -
  KU497_RS08395 (KU497_08385) - 1661555..1661962 (-) 408 WP_000565498.1 hypothetical protein -
  KU497_RS08400 (KU497_08390) - 1661959..1662363 (-) 405 WP_000114225.1 HK97 gp10 family phage protein -
  KU497_RS08405 (KU497_08395) - 1662360..1662722 (-) 363 WP_000755150.1 head-tail adaptor protein -
  KU497_RS08410 (KU497_08400) - 1662706..1662990 (-) 285 WP_000150936.1 phage head-tail adapter protein -
  KU497_RS08415 (KU497_08405) - 1662980..1663264 (-) 285 WP_000238236.1 hypothetical protein -
  KU497_RS08420 (KU497_08410) - 1663284..1664429 (-) 1146 WP_000154555.1 phage major capsid protein -
  KU497_RS08425 (KU497_08415) - 1664453..1665190 (-) 738 WP_000861914.1 head maturation protease, ClpP-related -
  KU497_RS08430 (KU497_08420) - 1665174..1666361 (-) 1188 WP_000025274.1 phage portal protein -
  KU497_RS08435 (KU497_08425) - 1666377..1668038 (-) 1662 WP_000625088.1 terminase large subunit -
  KU497_RS08440 (KU497_08430) - 1668035..1668379 (-) 345 WP_000402904.1 hypothetical protein -
  KU497_RS08445 (KU497_08435) - 1668511..1668810 (-) 300 WP_000988336.1 HNH endonuclease -
  KU497_RS08450 (KU497_08440) - 1669042..1669458 (-) 417 WP_000590126.1 hypothetical protein -
  KU497_RS08455 (KU497_08445) - 1669486..1669686 (-) 201 WP_000265041.1 DUF1514 family protein -
  KU497_RS08460 (KU497_08450) rinB 1669686..1669835 (-) 150 WP_000595265.1 transcriptional activator RinB -
  KU497_RS08465 (KU497_08455) - 1669832..1670038 (-) 207 WP_000195820.1 DUF1381 domain-containing protein -
  KU497_RS08470 (KU497_08460) - 1670075..1670611 (-) 537 WP_001066444.1 dUTPase -
  KU497_RS08475 (KU497_08465) - 1670604..1671014 (-) 411 WP_000197967.1 hypothetical protein -
  KU497_RS08480 (KU497_08470) - 1671011..1671520 (-) 510 WP_001105598.1 hypothetical protein -
  KU497_RS08485 (KU497_08475) - 1671517..1671966 (-) 450 WP_000982711.1 YopX family protein -
  KU497_RS08490 (KU497_08480) - 1672031..1672273 (-) 243 WP_000131366.1 SAV1978 family virulence-associated passenger protein -
  KU497_RS08495 (KU497_08485) - 1672277..1672645 (-) 369 WP_000101274.1 SA1788 family PVL leukocidin-associated protein -
  KU497_RS08500 (KU497_08490) - 1672658..1673062 (-) 405 WP_000401964.1 RusA family crossover junction endodeoxyribonuclease -
  KU497_RS08505 (KU497_08495) - 1673071..1673289 (-) 219 WP_000338528.1 hypothetical protein -
  KU497_RS08510 (KU497_08500) - 1673296..1674180 (-) 885 WP_000148301.1 DnaD domain protein -
  KU497_RS08515 (KU497_08505) ssbA 1674210..1674680 (-) 471 WP_000934770.1 single-stranded DNA-binding protein Machinery gene
  KU497_RS08520 (KU497_08510) - 1674681..1675298 (-) 618 WP_071621397.1 MBL fold metallo-hydrolase -
  KU497_RS08525 (KU497_08515) - 1675379..1676299 (-) 921 WP_000138481.1 recombinase RecT -
  KU497_RS08530 (KU497_08520) - 1676301..1678244 (-) 1944 WP_000700562.1 AAA family ATPase -
  KU497_RS08535 (KU497_08525) - 1678253..1678516 (-) 264 WP_001205732.1 hypothetical protein -
  KU497_RS08540 (KU497_08530) - 1678525..1678785 (-) 261 WP_000291489.1 DUF1108 family protein -
  KU497_RS08545 (KU497_08535) - 1678878..1679039 (-) 162 WP_050956528.1 DUF1270 domain-containing protein -
  KU497_RS08550 (KU497_08540) - 1679032..1679253 (-) 222 WP_000594790.1 hypothetical protein -
  KU497_RS08555 (KU497_08545) - 1679324..1679956 (+) 633 WP_050956527.1 hypothetical protein -
  KU497_RS08560 (KU497_08550) - 1679971..1680111 (-) 141 WP_000939496.1 hypothetical protein -
  KU497_RS08565 (KU497_08555) - 1680142..1680336 (-) 195 WP_000388066.1 hypothetical protein -
  KU497_RS08570 (KU497_08560) - 1680353..1681105 (-) 753 WP_001148618.1 phage antirepressor KilAC domain-containing protein -
  KU497_RS08575 (KU497_08565) - 1681162..1681701 (+) 540 WP_000351243.1 hypothetical protein -
  KU497_RS08580 (KU497_08570) - 1681725..1681985 (-) 261 WP_000435341.1 transcriptional regulator -
  KU497_RS08585 (KU497_08575) - 1682011..1682787 (-) 777 WP_031900794.1 Rha family transcriptional regulator -
  KU497_RS08590 (KU497_08580) - 1682810..1683037 (-) 228 WP_015978369.1 helix-turn-helix transcriptional regulator -
  KU497_RS08595 (KU497_08585) - 1683191..1683820 (+) 630 WP_031881520.1 LexA family protein -
  KU497_RS08600 (KU497_08590) - 1683876..1684859 (+) 984 WP_001558608.1 glycosyltransferase family 2 protein -
  KU497_RS08605 (KU497_08595) - 1684870..1685112 (+) 243 WP_031900793.1 hypothetical protein -
  KU497_RS08610 (KU497_08600) - 1685179..1686228 (+) 1050 WP_031764589.1 tyrosine-type recombinase/integrase -
  KU497_RS08615 (KU497_08605) sufB 1686296..1687693 (-) 1398 WP_001074405.1 Fe-S cluster assembly protein SufB -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17713.63 Da        Isoelectric Point: 5.2672

>NTDB_id=584499 KU497_RS08515 WP_000934770.1 1674210..1674680(-) (ssbA) [Staphylococcus aureus strain 356]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANVPIEIDDNDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=584499 KU497_RS08515 WP_000934770.1 1674210..1674680(-) (ssbA) [Staphylococcus aureus strain 356]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGTTCCGATTGAAATAGATGACAATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.367

100

0.628

  ssb Latilactobacillus sakei subsp. sakei 23K

50.588

100

0.551

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Glaesserella parasuis strain SC1401

32.203

100

0.365