Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   KU500_RS13590 Genome accession   NZ_CP077867
Coordinates   2771231..2771701 (+) Length   156 a.a.
NCBI ID   WP_000934770.1    Uniprot ID   -
Organism   Staphylococcus aureus strain 367     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2757087..2786334 2771231..2771701 within 0


Gene organization within MGE regions


Location: 2757087..2786334
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KU500_RS13470 (KU500_13430) pxpA 2757087..2757839 (+) 753 WP_001261799.1 5-oxoprolinase subunit PxpA -
  KU500_RS13475 (KU500_13435) - 2757903..2758940 (-) 1038 WP_000857198.1 tyrosine-type recombinase/integrase -
  KU500_RS13480 (KU500_13440) - 2759113..2759652 (-) 540 WP_000391618.1 type II toxin-antitoxin system PemK/MazF family toxin -
  KU500_RS13485 - 2759792..2759863 (-) 72 Protein_2619 hypothetical protein -
  KU500_RS13490 (KU500_13445) istA 2759944..2761236 (+) 1293 WP_000777467.1 IS21 family transposase -
  KU500_RS13495 (KU500_13450) istB 2761229..2761990 (+) 762 WP_001066124.1 IS21-like element helper ATPase IstB -
  KU500_RS13500 (KU500_13455) - 2762050..2762166 (-) 117 Protein_2622 hypothetical protein -
  KU500_RS13505 (KU500_13460) - 2762366..2762551 (-) 186 WP_001089804.1 hypothetical protein -
  KU500_RS13510 (KU500_13465) - 2762538..2762693 (-) 156 WP_001049399.1 hypothetical protein -
  KU500_RS13515 (KU500_13470) - 2762705..2763412 (-) 708 WP_000094093.1 helix-turn-helix domain-containing protein -
  KU500_RS13520 (KU500_13475) - 2763583..2763822 (+) 240 WP_000548578.1 helix-turn-helix transcriptional regulator -
  KU500_RS13525 (KU500_13480) - 2763835..2764095 (+) 261 WP_000435341.1 transcriptional regulator -
  KU500_RS13530 (KU500_13485) - 2764119..2764658 (-) 540 WP_000351243.1 hypothetical protein -
  KU500_RS13535 (KU500_13490) - 2764715..2765467 (+) 753 WP_225805747.1 phage antirepressor KilAC domain-containing protein -
  KU500_RS13540 (KU500_13495) - 2765484..2765678 (+) 195 WP_000388066.1 hypothetical protein -
  KU500_RS13545 (KU500_13500) - 2765709..2765849 (+) 141 WP_000939496.1 hypothetical protein -
  KU500_RS13550 (KU500_13505) - 2765864..2766496 (-) 633 WP_000275058.1 hypothetical protein -
  KU500_RS13555 (KU500_13510) - 2766555..2766875 (+) 321 WP_001120197.1 DUF771 domain-containing protein -
  KU500_RS13560 (KU500_13515) - 2766872..2767033 (+) 162 WP_000066020.1 DUF1270 domain-containing protein -
  KU500_RS13565 (KU500_13520) - 2767126..2767386 (+) 261 WP_000291489.1 DUF1108 family protein -
  KU500_RS13570 (KU500_13525) - 2767395..2767658 (+) 264 WP_001205732.1 hypothetical protein -
  KU500_RS13575 (KU500_13530) - 2767667..2769610 (+) 1944 WP_000700562.1 AAA family ATPase -
  KU500_RS13580 (KU500_13535) - 2769612..2770532 (+) 921 WP_000138481.1 recombinase RecT -
  KU500_RS13585 (KU500_13540) - 2770613..2771230 (+) 618 WP_071621397.1 MBL fold metallo-hydrolase -
  KU500_RS13590 (KU500_13545) ssbA 2771231..2771701 (+) 471 WP_000934770.1 single-stranded DNA-binding protein Machinery gene
  KU500_RS13595 (KU500_13550) - 2771731..2772615 (+) 885 WP_000148301.1 DnaD domain protein -
  KU500_RS13600 (KU500_13555) - 2772622..2772840 (+) 219 WP_000338528.1 hypothetical protein -
  KU500_RS13605 (KU500_13560) - 2772849..2773253 (+) 405 WP_000401964.1 RusA family crossover junction endodeoxyribonuclease -
  KU500_RS13610 (KU500_13565) - 2773266..2773634 (+) 369 WP_000101274.1 SA1788 family PVL leukocidin-associated protein -
  KU500_RS13615 (KU500_13570) - 2773638..2773880 (+) 243 WP_000131366.1 SAV1978 family virulence-associated passenger protein -
  KU500_RS13620 (KU500_13575) - 2773945..2774394 (+) 450 WP_000982711.1 YopX family protein -
  KU500_RS13625 (KU500_13580) - 2774391..2774900 (+) 510 WP_001105598.1 hypothetical protein -
  KU500_RS13630 (KU500_13585) - 2774897..2775307 (+) 411 WP_000197968.1 hypothetical protein -
  KU500_RS13635 - 2775300..2775425 (+) 126 Protein_2649 DUF1024 family protein -
  KU500_RS13640 (KU500_13595) - 2775781..2776317 (+) 537 WP_001066444.1 dUTPase -
  KU500_RS13645 (KU500_13600) - 2776354..2776560 (+) 207 WP_000195820.1 DUF1381 domain-containing protein -
  KU500_RS13650 (KU500_13605) rinB 2776557..2776706 (+) 150 WP_000595265.1 transcriptional activator RinB -
  KU500_RS13655 (KU500_13610) - 2776706..2776906 (+) 201 WP_000265041.1 DUF1514 family protein -
  KU500_RS13660 (KU500_13615) - 2776934..2777350 (+) 417 WP_000590126.1 hypothetical protein -
  KU500_RS13665 (KU500_13620) - 2777582..2777881 (+) 300 WP_000988336.1 HNH endonuclease -
  KU500_RS13670 (KU500_13625) - 2778011..2778355 (+) 345 WP_000402904.1 hypothetical protein -
  KU500_RS13675 (KU500_13630) - 2778352..2780013 (+) 1662 WP_000625088.1 terminase large subunit -
  KU500_RS13680 (KU500_13635) - 2780029..2781216 (+) 1188 WP_000025274.1 phage portal protein -
  KU500_RS13685 (KU500_13640) - 2781200..2781937 (+) 738 WP_000861914.1 head maturation protease, ClpP-related -
  KU500_RS13690 (KU500_13645) - 2781961..2783106 (+) 1146 WP_000154555.1 phage major capsid protein -
  KU500_RS13695 (KU500_13650) - 2783126..2783410 (+) 285 WP_000238236.1 hypothetical protein -
  KU500_RS13700 (KU500_13655) - 2783400..2783684 (+) 285 WP_000150936.1 phage head-tail adapter protein -
  KU500_RS13705 (KU500_13660) - 2783668..2784030 (+) 363 WP_000755150.1 head-tail adaptor protein -
  KU500_RS13710 (KU500_13665) - 2784027..2784431 (+) 405 WP_000114225.1 HK97 gp10 family phage protein -
  KU500_RS13715 (KU500_13670) - 2784428..2784835 (+) 408 WP_000565498.1 hypothetical protein -
  KU500_RS13720 (KU500_13675) - 2784836..2785480 (+) 645 WP_000268741.1 major tail protein -
  KU500_RS13725 (KU500_13680) - 2785534..2785746 (+) 213 WP_230402383.1 Ig-like domain-containing protein -
  KU500_RS13730 (KU500_13685) gpG 2785796..2786146 (+) 351 WP_001096355.1 phage tail assembly chaperone G -
  KU500_RS13735 (KU500_13690) gpGT 2786197..2786334 (+) 138 WP_001549167.1 phage tail assembly chaperone GT -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17713.63 Da        Isoelectric Point: 5.2672

>NTDB_id=584255 KU500_RS13590 WP_000934770.1 2771231..2771701(+) (ssbA) [Staphylococcus aureus strain 367]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANVPIEIDDNDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=584255 KU500_RS13590 WP_000934770.1 2771231..2771701(+) (ssbA) [Staphylococcus aureus strain 367]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGTTCCGATTGAAATAGATGACAATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.367

100

0.628

  ssb Latilactobacillus sakei subsp. sakei 23K

50.588

100

0.551

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Glaesserella parasuis strain SC1401

32.203

100

0.365