Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   KU217_RS15450 Genome accession   NZ_CP077835
Coordinates   3276533..3276886 (-) Length   117 a.a.
NCBI ID   WP_071211529.1    Uniprot ID   A0A1S2G1T5
Organism   Acinetobacter baumannii strain DETAB-P65     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 3270862..3313292 3276533..3276886 within 0


Gene organization within MGE regions


Location: 3270862..3313292
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KU217_RS15420 (KU217_15365) - 3270862..3271809 (+) 948 WP_045544537.1 LysR substrate-binding domain-containing protein -
  KU217_RS15425 (KU217_15370) - 3271913..3273088 (-) 1176 WP_017816492.1 zinc-binding dehydrogenase -
  KU217_RS15430 (KU217_15375) add 3273490..3274485 (+) 996 WP_029423914.1 adenosine deaminase -
  KU217_RS15440 (KU217_15385) - 3275060..3276220 (-) 1161 WP_001272508.1 tyrosine-type recombinase/integrase -
  KU217_RS15445 (KU217_15390) - 3276309..3276512 (-) 204 WP_071211528.1 hypothetical protein -
  KU217_RS15450 (KU217_15395) ssb 3276533..3276886 (-) 354 WP_071211529.1 single-stranded DNA-binding protein Machinery gene
  KU217_RS15455 (KU217_15400) - 3276874..3277191 (-) 318 WP_000049659.1 hypothetical protein -
  KU217_RS15460 (KU217_15405) - 3277194..3277712 (-) 519 WP_071211530.1 hypothetical protein -
  KU217_RS15465 (KU217_15410) - 3277780..3278376 (-) 597 WP_000274818.1 hypothetical protein -
  KU217_RS15470 (KU217_15415) - 3278401..3281118 (-) 2718 WP_071211531.1 toprim domain-containing protein -
  KU217_RS15475 (KU217_15420) - 3281133..3281315 (-) 183 WP_001133583.1 hypothetical protein -
  KU217_RS15480 (KU217_15425) - 3281318..3281551 (-) 234 WP_000023425.1 hypothetical protein -
  KU217_RS15485 (KU217_15430) - 3281548..3281751 (-) 204 WP_071211532.1 hypothetical protein -
  KU217_RS15490 (KU217_15435) - 3281834..3282178 (+) 345 WP_071211533.1 hypothetical protein -
  KU217_RS15495 (KU217_15440) - 3282220..3282780 (-) 561 WP_071211547.1 hypothetical protein -
  KU217_RS15500 (KU217_15445) - 3282791..3282961 (-) 171 WP_171259127.1 hypothetical protein -
  KU217_RS15505 (KU217_15450) - 3283317..3284462 (+) 1146 WP_071211534.1 hypothetical protein -
  KU217_RS15510 (KU217_15455) - 3284519..3285052 (+) 534 WP_071211535.1 PAAR domain-containing protein -
  KU217_RS15515 (KU217_15460) - 3285058..3285669 (+) 612 WP_031966861.1 hypothetical protein -
  KU217_RS15520 (KU217_15465) - 3285671..3286141 (+) 471 WP_071211536.1 hypothetical protein -
  KU217_RS15525 (KU217_15470) - 3286253..3286540 (-) 288 WP_001214242.1 ogr/Delta-like zinc finger family protein -
  KU217_RS15535 (KU217_15480) - 3286819..3287610 (+) 792 WP_071211537.1 DNA adenine methylase -
  KU217_RS15540 (KU217_15485) - 3287607..3288827 (-) 1221 WP_071211538.1 contractile injection system protein, VgrG/Pvc8 family -
  KU217_RS15545 (KU217_15490) - 3288830..3289249 (-) 420 WP_000979932.1 phage tail protein -
  KU217_RS15550 (KU217_15495) - 3289266..3293186 (-) 3921 WP_071211539.1 phage tail protein -
  KU217_RS15555 - 3293183..3293254 (-) 72 WP_249308986.1 GpE family phage tail protein -
  KU217_RS15560 (KU217_15505) - 3293314..3293679 (-) 366 WP_062936698.1 phage tail assembly protein -
  KU217_RS15565 (KU217_15510) - 3293745..3294260 (-) 516 WP_001207577.1 phage major tail tube protein -
  KU217_RS15570 (KU217_15515) - 3294276..3295445 (-) 1170 WP_000785699.1 phage tail sheath protein -
  KU217_RS15575 (KU217_15520) - 3295555..3296049 (-) 495 WP_062936696.1 hypothetical protein -
  KU217_RS15580 (KU217_15525) - 3296049..3300635 (-) 4587 WP_071211540.1 phage tail protein -
  KU217_RS15585 (KU217_15530) - 3300636..3301172 (-) 537 WP_071211541.1 phage tail protein I -
  KU217_RS15590 (KU217_15535) - 3301172..3302089 (-) 918 WP_000117640.1 baseplate J/gp47 family protein -
  KU217_RS15595 (KU217_15540) - 3302086..3302436 (-) 351 WP_000062375.1 GPW/gp25 family protein -
  KU217_RS15600 (KU217_15545) - 3302433..3303023 (-) 591 WP_001026776.1 phage baseplate assembly protein V -
  KU217_RS15605 (KU217_15550) - 3303411..3303872 (-) 462 WP_000774613.1 phage virion morphogenesis protein -
  KU217_RS15610 (KU217_15555) - 3303875..3304405 (-) 531 WP_000735813.1 phage tail protein -
  KU217_RS15615 (KU217_15560) - 3304402..3305232 (-) 831 WP_000600985.1 N-acetylmuramidase family protein -
  KU217_RS15620 (KU217_15565) - 3305229..3305486 (-) 258 WP_000604752.1 phage holin family protein -
  KU217_RS15625 (KU217_15570) - 3305483..3305842 (-) 360 WP_001114932.1 putative holin -
  KU217_RS15630 (KU217_15575) - 3305845..3306054 (-) 210 WP_001099130.1 tail protein X -
  KU217_RS15635 (KU217_15580) - 3306051..3306500 (-) 450 WP_000011350.1 head completion/stabilization protein -
  KU217_RS15640 (KU217_15585) gpM 3306607..3307353 (-) 747 WP_062936694.1 phage terminase small subunit -
  KU217_RS15645 (KU217_15590) - 3307359..3308369 (-) 1011 WP_001247975.1 phage major capsid protein, P2 family -
  KU217_RS15650 (KU217_15595) - 3308406..3309266 (-) 861 WP_071211542.1 GPO family capsid scaffolding protein -
  KU217_RS15655 (KU217_15600) - 3309444..3311222 (+) 1779 WP_071211543.1 terminase family protein -
  KU217_RS15660 (KU217_15605) - 3311219..3312268 (+) 1050 WP_062936692.1 phage portal protein -
  KU217_RS15665 (KU217_15610) - 3312278..3312493 (+) 216 WP_071211544.1 hypothetical protein -
  KU217_RS15670 (KU217_15615) - 3312610..3312789 (+) 180 WP_000009390.1 type II toxin-antitoxin system HicA family toxin -
  KU217_RS15675 (KU217_15620) - 3312879..3313292 (+) 414 WP_000878688.1 hypothetical protein -

Sequence


Protein


Download         Length: 117 a.a.        Molecular weight: 13331.01 Da        Isoelectric Point: 10.1439

>NTDB_id=583479 KU217_RS15450 WP_071211529.1 3276533..3276886(-) (ssb) [Acinetobacter baumannii strain DETAB-P65]
MRGVNKVILVGSLGADPITRQFPNGSSVTNFSIATSEKWQDKRTGDWIENTEWHRIVANNKLGEIAQKFLKKGSKVFIEG
SLRTRQWTDQNQNQFTVTEVRADHLQMLDSLPQANPY

Nucleotide


Download         Length: 354 bp        

>NTDB_id=583479 KU217_RS15450 WP_071211529.1 3276533..3276886(-) (ssb) [Acinetobacter baumannii strain DETAB-P65]
ATGCGTGGTGTAAATAAAGTCATTCTTGTAGGGAGTCTCGGAGCTGATCCTATTACAAGACAATTTCCGAATGGTTCTTC
AGTAACAAACTTTTCTATAGCTACTTCAGAAAAGTGGCAGGACAAACGTACTGGTGATTGGATAGAGAATACTGAGTGGC
ATCGAATTGTGGCTAACAACAAATTAGGAGAAATTGCTCAAAAATTTCTAAAAAAAGGTTCAAAAGTTTTCATCGAAGGC
TCTTTGCGTACACGTCAGTGGACTGATCAAAATCAAAATCAATTCACTGTGACAGAAGTAAGGGCAGATCACTTACAAAT
GCTGGATAGTCTTCCACAAGCAAACCCTTATTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A1S2G1T5

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

56.364

94.017

0.53

  ssb Vibrio cholerae strain A1552

55.556

84.615

0.47

  ssb Neisseria meningitidis MC58

46.667

89.744

0.419

  ssb Neisseria gonorrhoeae MS11

46.667

89.744

0.419