Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | KU217_RS15450 | Genome accession | NZ_CP077835 |
| Coordinates | 3276533..3276886 (-) | Length | 117 a.a. |
| NCBI ID | WP_071211529.1 | Uniprot ID | A0A1S2G1T5 |
| Organism | Acinetobacter baumannii strain DETAB-P65 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 3270862..3313292 | 3276533..3276886 | within | 0 |
Gene organization within MGE regions
Location: 3270862..3313292
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KU217_RS15420 (KU217_15365) | - | 3270862..3271809 (+) | 948 | WP_045544537.1 | LysR substrate-binding domain-containing protein | - |
| KU217_RS15425 (KU217_15370) | - | 3271913..3273088 (-) | 1176 | WP_017816492.1 | zinc-binding dehydrogenase | - |
| KU217_RS15430 (KU217_15375) | add | 3273490..3274485 (+) | 996 | WP_029423914.1 | adenosine deaminase | - |
| KU217_RS15440 (KU217_15385) | - | 3275060..3276220 (-) | 1161 | WP_001272508.1 | tyrosine-type recombinase/integrase | - |
| KU217_RS15445 (KU217_15390) | - | 3276309..3276512 (-) | 204 | WP_071211528.1 | hypothetical protein | - |
| KU217_RS15450 (KU217_15395) | ssb | 3276533..3276886 (-) | 354 | WP_071211529.1 | single-stranded DNA-binding protein | Machinery gene |
| KU217_RS15455 (KU217_15400) | - | 3276874..3277191 (-) | 318 | WP_000049659.1 | hypothetical protein | - |
| KU217_RS15460 (KU217_15405) | - | 3277194..3277712 (-) | 519 | WP_071211530.1 | hypothetical protein | - |
| KU217_RS15465 (KU217_15410) | - | 3277780..3278376 (-) | 597 | WP_000274818.1 | hypothetical protein | - |
| KU217_RS15470 (KU217_15415) | - | 3278401..3281118 (-) | 2718 | WP_071211531.1 | toprim domain-containing protein | - |
| KU217_RS15475 (KU217_15420) | - | 3281133..3281315 (-) | 183 | WP_001133583.1 | hypothetical protein | - |
| KU217_RS15480 (KU217_15425) | - | 3281318..3281551 (-) | 234 | WP_000023425.1 | hypothetical protein | - |
| KU217_RS15485 (KU217_15430) | - | 3281548..3281751 (-) | 204 | WP_071211532.1 | hypothetical protein | - |
| KU217_RS15490 (KU217_15435) | - | 3281834..3282178 (+) | 345 | WP_071211533.1 | hypothetical protein | - |
| KU217_RS15495 (KU217_15440) | - | 3282220..3282780 (-) | 561 | WP_071211547.1 | hypothetical protein | - |
| KU217_RS15500 (KU217_15445) | - | 3282791..3282961 (-) | 171 | WP_171259127.1 | hypothetical protein | - |
| KU217_RS15505 (KU217_15450) | - | 3283317..3284462 (+) | 1146 | WP_071211534.1 | hypothetical protein | - |
| KU217_RS15510 (KU217_15455) | - | 3284519..3285052 (+) | 534 | WP_071211535.1 | PAAR domain-containing protein | - |
| KU217_RS15515 (KU217_15460) | - | 3285058..3285669 (+) | 612 | WP_031966861.1 | hypothetical protein | - |
| KU217_RS15520 (KU217_15465) | - | 3285671..3286141 (+) | 471 | WP_071211536.1 | hypothetical protein | - |
| KU217_RS15525 (KU217_15470) | - | 3286253..3286540 (-) | 288 | WP_001214242.1 | ogr/Delta-like zinc finger family protein | - |
| KU217_RS15535 (KU217_15480) | - | 3286819..3287610 (+) | 792 | WP_071211537.1 | DNA adenine methylase | - |
| KU217_RS15540 (KU217_15485) | - | 3287607..3288827 (-) | 1221 | WP_071211538.1 | contractile injection system protein, VgrG/Pvc8 family | - |
| KU217_RS15545 (KU217_15490) | - | 3288830..3289249 (-) | 420 | WP_000979932.1 | phage tail protein | - |
| KU217_RS15550 (KU217_15495) | - | 3289266..3293186 (-) | 3921 | WP_071211539.1 | phage tail protein | - |
| KU217_RS15555 | - | 3293183..3293254 (-) | 72 | WP_249308986.1 | GpE family phage tail protein | - |
| KU217_RS15560 (KU217_15505) | - | 3293314..3293679 (-) | 366 | WP_062936698.1 | phage tail assembly protein | - |
| KU217_RS15565 (KU217_15510) | - | 3293745..3294260 (-) | 516 | WP_001207577.1 | phage major tail tube protein | - |
| KU217_RS15570 (KU217_15515) | - | 3294276..3295445 (-) | 1170 | WP_000785699.1 | phage tail sheath protein | - |
| KU217_RS15575 (KU217_15520) | - | 3295555..3296049 (-) | 495 | WP_062936696.1 | hypothetical protein | - |
| KU217_RS15580 (KU217_15525) | - | 3296049..3300635 (-) | 4587 | WP_071211540.1 | phage tail protein | - |
| KU217_RS15585 (KU217_15530) | - | 3300636..3301172 (-) | 537 | WP_071211541.1 | phage tail protein I | - |
| KU217_RS15590 (KU217_15535) | - | 3301172..3302089 (-) | 918 | WP_000117640.1 | baseplate J/gp47 family protein | - |
| KU217_RS15595 (KU217_15540) | - | 3302086..3302436 (-) | 351 | WP_000062375.1 | GPW/gp25 family protein | - |
| KU217_RS15600 (KU217_15545) | - | 3302433..3303023 (-) | 591 | WP_001026776.1 | phage baseplate assembly protein V | - |
| KU217_RS15605 (KU217_15550) | - | 3303411..3303872 (-) | 462 | WP_000774613.1 | phage virion morphogenesis protein | - |
| KU217_RS15610 (KU217_15555) | - | 3303875..3304405 (-) | 531 | WP_000735813.1 | phage tail protein | - |
| KU217_RS15615 (KU217_15560) | - | 3304402..3305232 (-) | 831 | WP_000600985.1 | N-acetylmuramidase family protein | - |
| KU217_RS15620 (KU217_15565) | - | 3305229..3305486 (-) | 258 | WP_000604752.1 | phage holin family protein | - |
| KU217_RS15625 (KU217_15570) | - | 3305483..3305842 (-) | 360 | WP_001114932.1 | putative holin | - |
| KU217_RS15630 (KU217_15575) | - | 3305845..3306054 (-) | 210 | WP_001099130.1 | tail protein X | - |
| KU217_RS15635 (KU217_15580) | - | 3306051..3306500 (-) | 450 | WP_000011350.1 | head completion/stabilization protein | - |
| KU217_RS15640 (KU217_15585) | gpM | 3306607..3307353 (-) | 747 | WP_062936694.1 | phage terminase small subunit | - |
| KU217_RS15645 (KU217_15590) | - | 3307359..3308369 (-) | 1011 | WP_001247975.1 | phage major capsid protein, P2 family | - |
| KU217_RS15650 (KU217_15595) | - | 3308406..3309266 (-) | 861 | WP_071211542.1 | GPO family capsid scaffolding protein | - |
| KU217_RS15655 (KU217_15600) | - | 3309444..3311222 (+) | 1779 | WP_071211543.1 | terminase family protein | - |
| KU217_RS15660 (KU217_15605) | - | 3311219..3312268 (+) | 1050 | WP_062936692.1 | phage portal protein | - |
| KU217_RS15665 (KU217_15610) | - | 3312278..3312493 (+) | 216 | WP_071211544.1 | hypothetical protein | - |
| KU217_RS15670 (KU217_15615) | - | 3312610..3312789 (+) | 180 | WP_000009390.1 | type II toxin-antitoxin system HicA family toxin | - |
| KU217_RS15675 (KU217_15620) | - | 3312879..3313292 (+) | 414 | WP_000878688.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 117 a.a. Molecular weight: 13331.01 Da Isoelectric Point: 10.1439
>NTDB_id=583479 KU217_RS15450 WP_071211529.1 3276533..3276886(-) (ssb) [Acinetobacter baumannii strain DETAB-P65]
MRGVNKVILVGSLGADPITRQFPNGSSVTNFSIATSEKWQDKRTGDWIENTEWHRIVANNKLGEIAQKFLKKGSKVFIEG
SLRTRQWTDQNQNQFTVTEVRADHLQMLDSLPQANPY
MRGVNKVILVGSLGADPITRQFPNGSSVTNFSIATSEKWQDKRTGDWIENTEWHRIVANNKLGEIAQKFLKKGSKVFIEG
SLRTRQWTDQNQNQFTVTEVRADHLQMLDSLPQANPY
Nucleotide
Download Length: 354 bp
>NTDB_id=583479 KU217_RS15450 WP_071211529.1 3276533..3276886(-) (ssb) [Acinetobacter baumannii strain DETAB-P65]
ATGCGTGGTGTAAATAAAGTCATTCTTGTAGGGAGTCTCGGAGCTGATCCTATTACAAGACAATTTCCGAATGGTTCTTC
AGTAACAAACTTTTCTATAGCTACTTCAGAAAAGTGGCAGGACAAACGTACTGGTGATTGGATAGAGAATACTGAGTGGC
ATCGAATTGTGGCTAACAACAAATTAGGAGAAATTGCTCAAAAATTTCTAAAAAAAGGTTCAAAAGTTTTCATCGAAGGC
TCTTTGCGTACACGTCAGTGGACTGATCAAAATCAAAATCAATTCACTGTGACAGAAGTAAGGGCAGATCACTTACAAAT
GCTGGATAGTCTTCCACAAGCAAACCCTTATTGA
ATGCGTGGTGTAAATAAAGTCATTCTTGTAGGGAGTCTCGGAGCTGATCCTATTACAAGACAATTTCCGAATGGTTCTTC
AGTAACAAACTTTTCTATAGCTACTTCAGAAAAGTGGCAGGACAAACGTACTGGTGATTGGATAGAGAATACTGAGTGGC
ATCGAATTGTGGCTAACAACAAATTAGGAGAAATTGCTCAAAAATTTCTAAAAAAAGGTTCAAAAGTTTTCATCGAAGGC
TCTTTGCGTACACGTCAGTGGACTGATCAAAATCAAAATCAATTCACTGTGACAGAAGTAAGGGCAGATCACTTACAAAT
GCTGGATAGTCTTCCACAAGCAAACCCTTATTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
56.364 |
94.017 |
0.53 |
| ssb | Vibrio cholerae strain A1552 |
55.556 |
84.615 |
0.47 |
| ssb | Neisseria meningitidis MC58 |
46.667 |
89.744 |
0.419 |
| ssb | Neisseria gonorrhoeae MS11 |
46.667 |
89.744 |
0.419 |