Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   KSF84_RS03700 Genome accession   NZ_CP077723
Coordinates   762443..762895 (+) Length   150 a.a.
NCBI ID   WP_064702813.1    Uniprot ID   -
Organism   Pasteurella multocida strain PMWSG-4     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 724776..770214 762443..762895 within 0


Gene organization within MGE regions


Location: 724776..770214
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KSF84_RS03445 (KSF84_03445) - 724776..725618 (+) 843 WP_005726500.1 patatin family protein -
  KSF84_RS03450 (KSF84_03450) - 725890..726147 (-) 258 WP_005725695.1 hypothetical protein -
  KSF84_RS03455 (KSF84_03455) - 726137..726724 (-) 588 WP_081106267.1 DUF4376 domain-containing protein -
  KSF84_RS03460 (KSF84_03460) - 726735..728456 (-) 1722 WP_064702775.1 tail fiber protein -
  KSF84_RS03465 (KSF84_03465) - 728468..732115 (-) 3648 WP_064702776.1 host specificity protein J -
  KSF84_RS03470 (KSF84_03470) - 732119..732844 (-) 726 WP_130555674.1 tail assembly protein -
  KSF84_RS03475 (KSF84_03475) - 732777..733490 (-) 714 WP_064702777.1 C40 family peptidase -
  KSF84_RS03480 (KSF84_03480) - 733492..734142 (-) 651 WP_064702778.1 phage minor tail protein L -
  KSF84_RS03485 (KSF84_03485) - 734161..734490 (-) 330 WP_064702779.1 phage tail protein -
  KSF84_RS03490 (KSF84_03490) - 734493..736958 (-) 2466 WP_231113976.1 phage tail length tape measure family protein -
  KSF84_RS03495 (KSF84_03495) - 736987..737382 (-) 396 WP_064702780.1 hypothetical protein -
  KSF84_RS03500 (KSF84_03500) - 737450..737914 (-) 465 WP_064702781.1 hypothetical protein -
  KSF84_RS03505 (KSF84_03505) - 737945..738616 (-) 672 WP_064702782.1 DUF6246 family protein -
  KSF84_RS03510 (KSF84_03510) - 738670..739152 (-) 483 WP_014390749.1 phage tail tube protein -
  KSF84_RS03515 (KSF84_03515) - 739164..739535 (-) 372 WP_064702783.1 hypothetical protein -
  KSF84_RS03520 (KSF84_03520) - 739532..739903 (-) 372 WP_064702784.1 hypothetical protein -
  KSF84_RS03525 (KSF84_03525) - 739908..740252 (-) 345 WP_064702785.1 hypothetical protein -
  KSF84_RS11435 - 740255..740623 (-) 369 WP_064702786.1 hypothetical protein -
  KSF84_RS11440 - 740604..741125 (-) 522 WP_233784711.1 hypothetical protein -
  KSF84_RS03540 (KSF84_03540) - 741136..742134 (-) 999 WP_064702788.1 major capsid protein -
  KSF84_RS03545 (KSF84_03545) - 742146..742580 (-) 435 WP_064702789.1 hypothetical protein -
  KSF84_RS03550 (KSF84_03550) - 742580..743926 (-) 1347 WP_064702790.1 DUF2213 domain-containing protein -
  KSF84_RS03555 (KSF84_03555) - 743941..744912 (-) 972 WP_135961492.1 phage minor head protein -
  KSF84_RS03560 (KSF84_03560) - 744866..746311 (-) 1446 WP_064702792.1 anti-CBASS protein Acb1 family protein -
  KSF84_RS03565 (KSF84_03565) - 746326..747549 (-) 1224 WP_064702793.1 PBSX family phage terminase large subunit -
  KSF84_RS03570 (KSF84_03570) - 747533..748069 (-) 537 WP_064702794.1 terminase small subunit -
  KSF84_RS03575 (KSF84_03575) - 748275..748535 (+) 261 WP_064702795.1 type II toxin-antitoxin system RelE family toxin -
  KSF84_RS03580 (KSF84_03580) - 748572..748940 (+) 369 WP_014391478.1 helix-turn-helix domain-containing protein -
  KSF84_RS03585 (KSF84_03585) - 749151..749474 (-) 324 WP_081273044.1 DUF2570 family protein -
  KSF84_RS03590 (KSF84_03590) - 749447..749977 (-) 531 WP_064702796.1 lysozyme -
  KSF84_RS03595 (KSF84_03595) - 749974..750270 (-) 297 WP_081273045.1 hypothetical protein -
  KSF84_RS03605 (KSF84_03605) - 750587..751090 (-) 504 WP_064702797.1 antiterminator Q family protein -
  KSF84_RS03610 (KSF84_03610) - 751087..751668 (-) 582 WP_130555676.1 recombination protein NinG -
  KSF84_RS03615 (KSF84_03615) - 751880..752035 (-) 156 WP_155736201.1 hypothetical protein -
  KSF84_RS03620 (KSF84_03620) - 752032..752274 (-) 243 WP_130555677.1 hypothetical protein -
  KSF84_RS03625 (KSF84_03625) - 752283..752483 (-) 201 WP_064702801.1 hypothetical protein -
  KSF84_RS03630 (KSF84_03630) - 752557..752982 (-) 426 WP_064702802.1 recombination protein NinB -
  KSF84_RS03635 (KSF84_03635) - 752986..754422 (-) 1437 WP_064702803.1 DnaB-like helicase C-terminal domain-containing protein -
  KSF84_RS03640 (KSF84_03640) - 754422..755312 (-) 891 WP_081273046.1 replication protein -
  KSF84_RS03645 (KSF84_03645) - 755549..756001 (-) 453 WP_014390720.1 phage regulatory CII family protein -
  KSF84_RS03650 (KSF84_03650) - 756050..756250 (-) 201 WP_064702804.1 transcriptional regulator -
  KSF84_RS03655 (KSF84_03655) - 756372..757058 (+) 687 WP_135961491.1 helix-turn-helix transcriptional regulator -
  KSF84_RS03660 (KSF84_03660) - 757183..757791 (+) 609 WP_064702806.1 hypothetical protein -
  KSF84_RS03665 (KSF84_03665) - 757794..758696 (+) 903 WP_061406091.1 hypothetical protein -
  KSF84_RS03670 (KSF84_03670) - 759140..759367 (+) 228 WP_064702807.1 hypothetical protein -
  KSF84_RS03675 (KSF84_03675) - 759515..760156 (+) 642 WP_064702808.1 DUF3560 domain-containing protein -
  KSF84_RS03680 (KSF84_03680) - 760201..760482 (+) 282 WP_064702809.1 hypothetical protein -
  KSF84_RS03685 (KSF84_03685) - 760659..760871 (+) 213 WP_064702810.1 hypothetical protein -
  KSF84_RS03690 (KSF84_03690) - 761044..761688 (+) 645 WP_064702811.1 ribonuclease H-like domain-containing protein -
  KSF84_RS03695 (KSF84_03695) - 761731..762432 (+) 702 WP_064702812.1 ERF family protein -
  KSF84_RS03700 (KSF84_03700) ssb 762443..762895 (+) 453 WP_064702813.1 single-stranded DNA-binding protein Machinery gene
  KSF84_RS03705 (KSF84_03705) - 762906..763103 (+) 198 WP_064702814.1 hypothetical protein -
  KSF84_RS03710 (KSF84_03710) - 763354..764259 (+) 906 WP_064702815.1 SPFH domain-containing protein -
  KSF84_RS03715 (KSF84_03715) - 764309..764572 (+) 264 WP_064702816.1 hypothetical protein -
  KSF84_RS03720 (KSF84_03720) - 764603..765277 (+) 675 WP_064702817.1 hypothetical protein -
  KSF84_RS03725 (KSF84_03725) - 765264..765602 (+) 339 WP_064702818.1 hypothetical protein -
  KSF84_RS03730 (KSF84_03730) - 765678..765887 (+) 210 WP_064702819.1 hypothetical protein -
  KSF84_RS03735 (KSF84_03735) rdgC 765918..766826 (+) 909 WP_064702820.1 recombination-associated protein RdgC -
  KSF84_RS03740 (KSF84_03740) - 766970..767446 (+) 477 WP_064702821.1 hypothetical protein -
  KSF84_RS03745 (KSF84_03745) - 767455..767688 (+) 234 WP_064702822.1 DUF551 domain-containing protein -
  KSF84_RS03750 (KSF84_03750) - 767700..768005 (+) 306 WP_064702823.1 hypothetical protein -
  KSF84_RS03755 (KSF84_03755) - 768052..768318 (+) 267 WP_064702824.1 hypothetical protein -
  KSF84_RS11445 - 768325..768795 (+) 471 WP_064702825.1 hypothetical protein -
  KSF84_RS03765 (KSF84_03765) - 768930..769181 (+) 252 WP_052719234.1 DUF4224 domain-containing protein -
  KSF84_RS03770 (KSF84_03770) - 769183..770214 (+) 1032 WP_064702826.1 tyrosine-type recombinase/integrase -

Sequence

Protein


Download         Length: 150 a.a.        Molecular weight: 16866.74 Da        Isoelectric Point: 6.9807

>NTDB_id=582504 KSF84_RS03700 WP_064702813.1 762443..762895(+) (ssb) [Pasteurella multocida strain PMWSG-4]
MAGVNLVIILGNLGNDPDIRTMPNGEAVAKISVATSESWIDKNTGERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
RLKTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQPQPQAQAPQNNAYANAKSGKPAQQAYSFEDDSIPF

Nucleotide


Download         Length: 453 bp        

>NTDB_id=582504 KSF84_RS03700 WP_064702813.1 762443..762895(+) (ssb) [Pasteurella multocida strain PMWSG-4]
ATGGCTGGGGTTAATCTTGTAATTATTTTAGGAAATTTAGGAAACGATCCTGATATCCGCACAATGCCAAATGGCGAAGC
AGTGGCAAAAATCAGCGTCGCAACTAGTGAAAGCTGGATTGATAAAAACACTGGCGAGCGCAAAACACAAACAGAATGGC
ACTCTATTGTGTTCTACCGTCGCCAAGCAGAAATTTGCGGTCAGTATCTCAAAAAAGGATCGAAAGTGTATGTGGAAGGG
CGTTTAAAAACTCGTAAGTGGCAAGACCAAAACGGGCAAGATCGCTACACAACTGAAATCCAAGGTGACGTATTGCAGAT
GTTAGACAGTCGCCAAGATTCGCAACCGCAACCGCAAGCACAGGCACCACAAAACAACGCTTATGCGAATGCGAAAAGTG
GAAAGCCAGCGCAACAGGCTTATAGTTTTGAAGATGATAGCATACCTTTTTAG

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(4-108)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

61.878

100

0.747
  ssb Vibrio cholerae strain A1552

53.521

94.667

0.507
  ssb Neisseria gonorrhoeae MS11

46.763

92.667

0.433
  ssb Neisseria meningitidis MC58

46.763

92.667

0.433