Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   I6L81_RS19725 Genome accession   NZ_CP077388
Coordinates   4339290..4339787 (-) Length   165 a.a.
NCBI ID   WP_217008185.1    Uniprot ID   -
Organism   Providencia rettgeri strain FDAARGOS 1451     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 4324008..4383561 4339290..4339787 within 0


Gene organization within MGE regions


Location: 4324008..4383561
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I6L81_RS19635 (I6L81_19635) - 4324008..4324703 (-) 696 WP_131680685.1 hypothetical protein -
  I6L81_RS19640 (I6L81_19640) - 4324884..4325192 (-) 309 WP_042847942.1 DUF5339 domain-containing protein -
  I6L81_RS19645 (I6L81_19645) fliZ 4326212..4326727 (+) 516 WP_042847941.1 flagella biosynthesis regulatory protein FliZ -
  I6L81_RS19650 (I6L81_19650) putA 4326988..4330971 (-) 3984 WP_254178414.1 trifunctional transcriptional regulator/proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase -
  I6L81_RS19655 (I6L81_19655) putP 4331472..4332956 (+) 1485 WP_042847939.1 sodium/proline symporter PutP -
  I6L81_RS19660 (I6L81_19660) cycA 4333051..4334451 (-) 1401 WP_042847937.1 D-serine/D-alanine/glycine transporter -
  I6L81_RS19670 (I6L81_19670) - 4334816..4335880 (-) 1065 WP_187710155.1 site-specific integrase -
  I6L81_RS19680 (I6L81_19680) - 4336336..4336542 (-) 207 WP_217008177.1 DUF4060 family protein -
  I6L81_RS19685 (I6L81_19685) - 4336567..4336758 (-) 192 WP_217008178.1 hypothetical protein -
  I6L81_RS19690 (I6L81_19690) - 4336751..4336975 (-) 225 WP_217008179.1 hypothetical protein -
  I6L81_RS19695 (I6L81_19695) - 4336972..4337328 (-) 357 WP_217008180.1 phage protein NinX family protein -
  I6L81_RS19700 (I6L81_19700) - 4337321..4337506 (-) 186 WP_217008181.1 hypothetical protein -
  I6L81_RS19705 (I6L81_19705) - 4337664..4337912 (-) 249 WP_217008182.1 hypothetical protein -
  I6L81_RS19710 (I6L81_19710) - 4337902..4338144 (-) 243 WP_217008183.1 hypothetical protein -
  I6L81_RS19715 (I6L81_19715) - 4338144..4338344 (-) 201 WP_096864895.1 hypothetical protein -
  I6L81_RS19720 (I6L81_19720) - 4338344..4338625 (-) 282 WP_217008184.1 hypothetical protein -
  I6L81_RS19725 (I6L81_19725) ssb 4339290..4339787 (-) 498 WP_217008185.1 single-stranded DNA-binding protein Machinery gene
  I6L81_RS19730 (I6L81_19730) - 4339772..4340281 (-) 510 WP_217008186.1 HNH endonuclease signature motif containing protein -
  I6L81_RS19735 (I6L81_19735) - 4340296..4341168 (-) 873 WP_217008187.1 ATP-binding protein -
  I6L81_RS19740 (I6L81_19740) - 4341184..4341522 (-) 339 WP_217008188.1 hypothetical protein -
  I6L81_RS20380 (I6L81_19745) - 4341515..4341667 (-) 153 WP_217008189.1 hypothetical protein -
  I6L81_RS20385 (I6L81_19750) - 4341664..4341864 (-) 201 WP_166687446.1 hypothetical protein -
  I6L81_RS20390 (I6L81_19755) - 4341868..4342017 (-) 150 WP_165568291.1 hypothetical protein -
  I6L81_RS19760 (I6L81_19760) - 4342082..4342519 (-) 438 WP_217008190.1 hypothetical protein -
  I6L81_RS19765 (I6L81_19765) - 4342581..4342913 (-) 333 WP_217008191.1 hypothetical protein -
  I6L81_RS19770 (I6L81_19770) - 4342915..4343127 (-) 213 WP_129467332.1 hypothetical protein -
  I6L81_RS20395 - 4343124..4343513 (-) 390 WP_254178416.1 hypothetical protein -
  I6L81_RS20400 (I6L81_19780) - 4343547..4343810 (-) 264 WP_217008192.1 hypothetical protein -
  I6L81_RS19785 (I6L81_19785) - 4344174..4344482 (-) 309 WP_129467313.1 hypothetical protein -
  I6L81_RS19790 (I6L81_19790) - 4344932..4345438 (-) 507 WP_105881157.1 hypothetical protein -
  I6L81_RS19795 (I6L81_19795) - 4345455..4346516 (-) 1062 WP_129467312.1 hypothetical protein -
  I6L81_RS19800 (I6L81_19800) - 4346588..4346875 (-) 288 WP_240669311.1 DUF3024 domain-containing protein -
  I6L81_RS20265 - 4346956..4347090 (-) 135 WP_255254513.1 hypothetical protein -
  I6L81_RS19805 (I6L81_19805) - 4347239..4347910 (-) 672 WP_129467310.1 S24 family peptidase -
  I6L81_RS19810 (I6L81_19810) - 4348009..4348215 (+) 207 WP_105881154.1 helix-turn-helix transcriptional regulator -
  I6L81_RS19815 (I6L81_19815) - 4348348..4348668 (+) 321 WP_217008193.1 CII family transcriptional regulator -
  I6L81_RS19820 (I6L81_19820) - 4348788..4349114 (+) 327 WP_140180822.1 hypothetical protein -
  I6L81_RS19825 (I6L81_19825) - 4349375..4349809 (+) 435 WP_217008194.1 hypothetical protein -
  I6L81_RS19830 (I6L81_19830) - 4349812..4351449 (+) 1638 WP_217008195.1 DEAD/DEAH box helicase -
  I6L81_RS19835 (I6L81_19835) - 4351412..4352368 (+) 957 WP_217008196.1 primase-helicase zinc-binding domain-containing protein -
  I6L81_RS19840 (I6L81_19840) - 4352394..4352684 (+) 291 WP_217008197.1 hypothetical protein -
  I6L81_RS19845 (I6L81_19845) - 4352684..4352953 (+) 270 WP_217008198.1 hypothetical protein -
  I6L81_RS19850 (I6L81_19850) - 4352940..4353140 (+) 201 WP_217008199.1 hypothetical protein -
  I6L81_RS20405 (I6L81_19855) - 4353140..4353469 (+) 330 WP_217008200.1 phage protein NinX family protein -
  I6L81_RS19860 (I6L81_19860) - 4353472..4353720 (+) 249 WP_217008201.1 hypothetical protein -
  I6L81_RS19865 (I6L81_19865) - 4353741..4354214 (+) 474 WP_217008202.1 recombination protein NinB -
  I6L81_RS19870 (I6L81_19870) - 4354211..4354408 (+) 198 WP_217008203.1 hypothetical protein -
  I6L81_RS19875 (I6L81_19875) - 4354401..4354991 (+) 591 WP_217008204.1 recombination protein NinG -
  I6L81_RS19880 (I6L81_19880) - 4355196..4355834 (+) 639 WP_217008205.1 hypothetical protein -
  I6L81_RS19885 (I6L81_19885) - 4356191..4356604 (+) 414 WP_071548375.1 putative holin -
  I6L81_RS20410 (I6L81_19890) - 4356601..4356879 (+) 279 WP_071548373.1 hypothetical protein -
  I6L81_RS19895 (I6L81_19895) - 4356866..4357348 (+) 483 WP_217008206.1 TIGR02594 family protein -
  I6L81_RS20415 (I6L81_19900) - 4357350..4357682 (+) 333 WP_217008207.1 hypothetical protein -
  I6L81_RS19905 (I6L81_19905) - 4358053..4358436 (+) 384 WP_147675383.1 Gp49 family protein -
  I6L81_RS19910 (I6L81_19910) - 4358755..4359267 (+) 513 WP_147675382.1 KilA-N domain-containing protein -
  I6L81_RS19915 (I6L81_19915) - 4359384..4359623 (+) 240 WP_147675381.1 hypothetical protein -
  I6L81_RS19920 (I6L81_19920) - 4359634..4359846 (+) 213 WP_129467051.1 hypothetical protein -
  I6L81_RS19925 (I6L81_19925) - 4359915..4360331 (+) 417 WP_210815441.1 hypothetical protein -
  I6L81_RS20420 (I6L81_19930) - 4360328..4360483 (+) 156 WP_166687374.1 hypothetical protein -
  I6L81_RS19935 (I6L81_19935) - 4360499..4360759 (+) 261 WP_036983118.1 DUF2560 family protein -
  I6L81_RS19940 (I6L81_19940) - 4360814..4361329 (+) 516 WP_217008208.1 hypothetical protein -
  I6L81_RS19945 (I6L81_19945) - 4361332..4362816 (+) 1485 WP_217008209.1 terminase -
  I6L81_RS19950 (I6L81_19950) - 4362818..4364194 (+) 1377 WP_217008210.1 DUF4055 domain-containing protein -
  I6L81_RS19955 (I6L81_19955) - 4364203..4365267 (+) 1065 WP_217008211.1 minor capsid protein -
  I6L81_RS19960 (I6L81_19960) - 4365342..4366028 (+) 687 WP_129467063.1 hypothetical protein -
  I6L81_RS19965 (I6L81_19965) - 4366034..4366981 (+) 948 WP_105881124.1 major capsid protein -
  I6L81_RS19970 (I6L81_19970) - 4367024..4367401 (+) 378 WP_211889573.1 hypothetical protein -
  I6L81_RS19975 (I6L81_19975) - 4367403..4367774 (+) 372 WP_131679885.1 hypothetical protein -
  I6L81_RS19980 (I6L81_19980) - 4367776..4368132 (+) 357 WP_131679886.1 HK97 gp10 family phage protein -
  I6L81_RS19985 (I6L81_19985) - 4368129..4368497 (+) 369 WP_211889574.1 hypothetical protein -
  I6L81_RS19990 (I6L81_19990) - 4368559..4369299 (+) 741 WP_042847850.1 Ig-like domain-containing protein -
  I6L81_RS19995 (I6L81_19995) - 4369348..4370028 (+) 681 WP_217008212.1 DUF6246 family protein -
  I6L81_RS20000 (I6L81_20000) - 4370056..4370979 (-) 924 WP_217008213.1 hypothetical protein -
  I6L81_RS20005 (I6L81_20005) - 4370982..4371233 (-) 252 WP_217008214.1 Arc family DNA-binding protein -
  I6L81_RS20010 (I6L81_20010) umuD 4371458..4371871 (+) 414 WP_217008215.1 translesion error-prone DNA polymerase V autoproteolytic subunit -
  I6L81_RS20015 (I6L81_20015) umuC 4371871..4373133 (+) 1263 WP_217008216.1 translesion error-prone DNA polymerase V subunit UmuC -
  I6L81_RS20020 (I6L81_20020) - 4373294..4375753 (+) 2460 WP_217008217.1 hypothetical protein -
  I6L81_RS20025 (I6L81_20025) - 4376115..4376414 (+) 300 WP_217008218.1 hypothetical protein -
  I6L81_RS20030 (I6L81_20030) - 4376520..4379750 (+) 3231 WP_217008219.1 tape measure protein -
  I6L81_RS20035 (I6L81_20035) - 4379759..4380244 (+) 486 WP_217008220.1 hypothetical protein -
  I6L81_RS20040 (I6L81_20040) - 4380241..4380708 (+) 468 WP_210782033.1 DUF1833 family protein -
  I6L81_RS20045 (I6L81_20045) - 4380708..4381100 (+) 393 WP_217008221.1 NlpC/P60 family protein -
  I6L81_RS20050 (I6L81_20050) - 4381087..4383561 (+) 2475 WP_217008222.1 host specificity factor TipJ family phage tail protein -

Sequence


Protein


Download         Length: 165 a.a.        Molecular weight: 18406.72 Da        Isoelectric Point: 6.7195

>NTDB_id=581081 I6L81_RS19725 WP_217008185.1 4339290..4339787(-) (ssb) [Providencia rettgeri strain FDAARGOS 1451]
MEPHLMSRGVNKVILIGNTCDDPTVRYMPNGGAVTNFTLATNDYWTDKQTGQKKEKAEFHRVVIFGKLAEVAGEYLKKGS
QVYIEGFLQTRKWQDQSGQDRYTTEVVVNIGGSMQMLGGNGGSNQAGSQQPARQTQQNEPPMDWDDQIPFAPIGLPYPRH
AIYVI

Nucleotide


Download         Length: 498 bp        

>NTDB_id=581081 I6L81_RS19725 WP_217008185.1 4339290..4339787(-) (ssb) [Providencia rettgeri strain FDAARGOS 1451]
ATGGAGCCACATCTAATGTCTAGAGGCGTAAATAAGGTCATATTAATTGGAAATACTTGTGATGACCCGACTGTTAGATA
CATGCCAAATGGCGGTGCTGTCACCAACTTTACATTAGCAACAAATGACTACTGGACTGACAAACAAACAGGACAAAAGA
AAGAAAAAGCTGAGTTTCACCGTGTGGTAATTTTCGGCAAGTTAGCTGAAGTTGCAGGTGAATATCTGAAAAAAGGCTCA
CAAGTCTATATCGAAGGTTTCTTGCAAACCAGAAAATGGCAAGACCAGAGCGGGCAAGACCGATACACAACGGAAGTGGT
AGTTAATATCGGTGGCTCTATGCAAATGCTAGGCGGTAACGGTGGTAGCAATCAAGCAGGGAGTCAGCAGCCAGCGCGAC
AAACTCAGCAGAATGAGCCACCGATGGATTGGGATGACCAAATACCTTTCGCTCCTATCGGACTCCCCTACCCACGCCAC
GCTATTTATGTGATTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

61.582

100

0.661

  ssb Glaesserella parasuis strain SC1401

48.066

100

0.527

  ssb Neisseria meningitidis MC58

43.114

100

0.436

  ssb Neisseria gonorrhoeae MS11

43.636

100

0.436