Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   I6L32_RS02575 Genome accession   NZ_CP077201
Coordinates   544692..545165 (+) Length   157 a.a.
NCBI ID   WP_103244313.1    Uniprot ID   -
Organism   Aeromonas sp. FDAARGOS 1402     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 491169..546724 544692..545165 within 0


Gene organization within MGE regions


Location: 491169..546724
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I6L32_RS02250 (I6L32_02250) - 491169..492011 (+) 843 WP_010673217.1 lytic transglycosylase domain-containing protein -
  I6L32_RS02255 (I6L32_02255) - 492565..492846 (-) 282 WP_216944600.1 DUF2845 domain-containing protein -
  I6L32_RS02260 (I6L32_02260) - 492881..493117 (-) 237 WP_216944601.1 hypothetical protein -
  I6L32_RS02265 (I6L32_02265) - 493118..495025 (-) 1908 WP_216944602.1 hypothetical protein -
  I6L32_RS02270 (I6L32_02270) - 495025..495576 (-) 552 WP_216944603.1 hypothetical protein -
  I6L32_RS02275 (I6L32_02275) - 495586..496647 (-) 1062 WP_216944604.1 hypothetical protein -
  I6L32_RS02280 (I6L32_02280) - 496644..496910 (-) 267 WP_216944605.1 hypothetical protein -
  I6L32_RS02285 (I6L32_02285) - 496953..500423 (-) 3471 WP_216944606.1 hypothetical protein -
  I6L32_RS02290 (I6L32_02290) - 500427..500804 (-) 378 WP_216944607.1 hypothetical protein -
  I6L32_RS02295 (I6L32_02295) - 500801..504385 (-) 3585 WP_216944608.1 tape measure protein -
  I6L32_RS23615 (I6L32_02300) - 504758..505054 (+) 297 WP_367950695.1 HNH endonuclease -
  I6L32_RS02305 (I6L32_02305) - 505102..505851 (-) 750 WP_216944609.1 hypothetical protein -
  I6L32_RS02310 (I6L32_02310) - 505891..506313 (-) 423 WP_216944610.1 DUF3168 domain-containing protein -
  I6L32_RS02315 (I6L32_02315) - 506310..506867 (-) 558 WP_216944611.1 hypothetical protein -
  I6L32_RS02320 (I6L32_02320) - 506867..507406 (-) 540 WP_216944612.1 head-tail adaptor protein -
  I6L32_RS02325 (I6L32_02325) - 507415..507726 (-) 312 WP_042016765.1 head-tail connector protein -
  I6L32_RS02330 (I6L32_02330) - 507729..507902 (-) 174 WP_216944613.1 hypothetical protein -
  I6L32_RS02335 (I6L32_02335) - 507969..509255 (-) 1287 WP_216944614.1 phage major capsid protein -
  I6L32_RS02340 (I6L32_02340) - 509324..510259 (-) 936 WP_216944615.1 S49 family peptidase -
  I6L32_RS02345 (I6L32_02345) - 510247..511500 (-) 1254 WP_216944616.1 phage portal protein -
  I6L32_RS02350 (I6L32_02350) - 511500..511688 (-) 189 WP_033130572.1 hypothetical protein -
  I6L32_RS02355 (I6L32_02355) - 511682..513403 (-) 1722 WP_042016759.1 terminase large subunit -
  I6L32_RS02360 (I6L32_02360) - 513413..513898 (-) 486 WP_042016758.1 phage terminase small subunit P27 family -
  I6L32_RS02365 (I6L32_02365) - 513994..514374 (-) 381 WP_216944617.1 HNH endonuclease -
  I6L32_RS02370 (I6L32_02370) - 514461..514979 (-) 519 WP_216944618.1 DUF2514 family protein -
  I6L32_RS02375 (I6L32_02375) - 514976..515494 (-) 519 WP_216944619.1 lysozyme -
  I6L32_RS02380 (I6L32_02380) - 515481..515810 (-) 330 WP_232038119.1 phage holin, lambda family -
  I6L32_RS02385 (I6L32_02385) - 516079..517059 (-) 981 WP_000019402.1 IS5-like element IS5 family transposase -
  I6L32_RS02390 (I6L32_02390) - 517446..519947 (-) 2502 WP_254203871.1 S8 family peptidase -
  I6L32_RS02395 (I6L32_02395) - 519963..520958 (-) 996 WP_216944620.1 AAA family ATPase -
  I6L32_RS02400 (I6L32_02400) - 521161..522222 (-) 1062 WP_216944621.1 site-specific DNA-methyltransferase -
  I6L32_RS23620 (I6L32_02405) - 522134..522352 (-) 219 WP_216944622.1 Com family DNA-binding transcriptional regulator -
  I6L32_RS02410 (I6L32_02410) - 522788..523729 (+) 942 WP_216944623.1 chromate resistance protein ChrB domain-containing protein -
  I6L32_RS02415 (I6L32_02415) chrA 523722..525092 (+) 1371 WP_216944624.1 chromate efflux transporter -
  I6L32_RS02420 (I6L32_02420) - 525098..525472 (-) 375 WP_216944625.1 hypothetical protein -
  I6L32_RS02425 (I6L32_02425) - 525483..526634 (-) 1152 WP_216944626.1 nickel/cobalt efflux protein RcnA -
  I6L32_RS02430 (I6L32_02430) - 526643..526930 (-) 288 WP_216944627.1 metal-sensing transcriptional repressor -
  I6L32_RS02435 (I6L32_02435) - 527523..528179 (+) 657 WP_302056395.1 HupE/UreJ family protein -
  I6L32_RS02440 (I6L32_02440) - 528191..528883 (+) 693 WP_216944629.1 transmembrane anchor protein -
  I6L32_RS02445 (I6L32_02445) - 529061..530110 (+) 1050 WP_216944630.1 amidohydrolase family protein -
  I6L32_RS02450 (I6L32_02450) - 530342..530623 (-) 282 WP_216944631.1 hypothetical protein -
  I6L32_RS02455 (I6L32_02455) - 530793..531368 (-) 576 WP_254203872.1 antitermination protein -
  I6L32_RS02460 (I6L32_02460) - 531413..531766 (-) 354 WP_254203873.1 DUF1064 domain-containing protein -
  I6L32_RS02465 (I6L32_02465) - 531763..532752 (-) 990 WP_216944633.1 DUF968 domain-containing protein -
  I6L32_RS02470 (I6L32_02470) - 532749..533015 (-) 267 WP_216944634.1 hypothetical protein -
  I6L32_RS23625 (I6L32_02475) - 533005..533280 (-) 276 WP_367950690.1 DUF3283 family protein -
  I6L32_RS02480 (I6L32_02480) - 533222..533611 (-) 390 WP_216944636.1 DUF4406 domain-containing protein -
  I6L32_RS02485 (I6L32_02485) - 533601..533906 (-) 306 WP_216944637.1 hypothetical protein -
  I6L32_RS02490 (I6L32_02490) - 533899..534099 (-) 201 WP_216944638.1 hypothetical protein -
  I6L32_RS02495 (I6L32_02495) - 534096..534326 (-) 231 WP_254203874.1 hypothetical protein -
  I6L32_RS02500 (I6L32_02500) - 534323..534583 (-) 261 WP_216944639.1 hypothetical protein -
  I6L32_RS02505 (I6L32_02505) - 534583..535245 (-) 663 WP_216944640.1 replication protein P -
  I6L32_RS02510 (I6L32_02510) - 535245..536327 (-) 1083 WP_216944641.1 hypothetical protein -
  I6L32_RS02515 (I6L32_02515) - 536320..536463 (-) 144 WP_216944642.1 hypothetical protein -
  I6L32_RS02520 (I6L32_02520) - 536456..537064 (-) 609 WP_216944643.1 hypothetical protein -
  I6L32_RS02525 (I6L32_02525) - 537224..537682 (+) 459 WP_216944644.1 hypothetical protein -
  I6L32_RS02530 (I6L32_02530) - 537795..538301 (-) 507 WP_216944645.1 phage regulatory CII family protein -
  I6L32_RS23630 (I6L32_02535) - 538320..538559 (-) 240 WP_367950691.1 helix-turn-helix transcriptional regulator -
  I6L32_RS02540 (I6L32_02540) - 538629..539291 (+) 663 WP_139390322.1 LexA family transcriptional regulator -
  I6L32_RS02545 (I6L32_02545) - 539982..540185 (+) 204 WP_042016732.1 hypothetical protein -
  I6L32_RS23020 - 540223..541968 (+) 1746 WP_254203875.1 phage N-6-adenine-methyltransferase -
  I6L32_RS02555 (I6L32_02555) - 541965..543776 (+) 1812 WP_216944646.1 DNA cytosine methyltransferase -
  I6L32_RS02560 (I6L32_02560) - 543773..544210 (+) 438 WP_216944647.1 hypothetical protein -
  I6L32_RS02565 (I6L32_02565) - 544186..544380 (+) 195 WP_102948876.1 hypothetical protein -
  I6L32_RS02570 (I6L32_02570) - 544435..544692 (+) 258 WP_216944648.1 hypothetical protein -
  I6L32_RS02575 (I6L32_02575) ssb 544692..545165 (+) 474 WP_103244313.1 single-stranded DNA-binding protein Machinery gene
  I6L32_RS02580 (I6L32_02580) xisR 545232..545441 (+) 210 WP_033130544.1 excisionase family protein -
  I6L32_RS02585 (I6L32_02585) - 545417..546724 (+) 1308 WP_216944649.1 site-specific integrase -

Sequence

Protein


Download         Length: 157 a.a.        Molecular weight: 17171.25 Da        Isoelectric Point: 8.4053

>NTDB_id=579730 I6L32_RS02575 WP_103244313.1 544692..545165(+) (ssb) [Aeromonas sp. FDAARGOS 1402]
MASRGINKAILIGNLGQDPEVRYMPGGNAVTSITLATSDTWRDKQTGEAKERTEWHRVVFMGMLAEVAGKHLKKGSQVYV
EGKLRTRKWQDQSGQERYTTEVLVDSFTGVMQMLGGSGQNGGGKQQAAGSQQRPTPQPAQSPAYTEPPIAYDDDLPF

Nucleotide


Download         Length: 474 bp        

>NTDB_id=579730 I6L32_RS02575 WP_103244313.1 544692..545165(+) (ssb) [Aeromonas sp. FDAARGOS 1402]
ATGGCCAGCCGCGGTATCAACAAGGCCATCCTGATCGGCAACCTCGGCCAGGATCCGGAAGTGCGCTACATGCCCGGCGG
GAACGCTGTCACCAGCATCACCTTGGCGACCTCCGACACCTGGCGCGATAAGCAGACCGGCGAGGCCAAGGAGCGCACCG
AGTGGCATCGTGTCGTGTTCATGGGAATGTTGGCTGAGGTGGCAGGGAAGCACCTGAAGAAGGGCTCTCAGGTCTATGTG
GAGGGCAAACTGCGGACTCGTAAATGGCAGGACCAGAGCGGCCAGGAGCGCTACACCACCGAGGTGCTCGTGGACAGCTT
CACAGGGGTGATGCAGATGCTGGGAGGAAGCGGGCAAAACGGAGGAGGGAAACAGCAAGCGGCAGGCAGCCAGCAAAGGC
CAACGCCACAGCCGGCGCAATCACCGGCCTACACCGAACCACCGATCGCTTATGACGACGATCTGCCGTTCTAG

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(6-107)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

59.887

100

0.675
  ssb Glaesserella parasuis strain SC1401

48.901

100

0.567
  ssb Neisseria gonorrhoeae MS11

40.678

100

0.459
  ssb Neisseria meningitidis MC58

40.678

100

0.459