Detailed information NTG0578253

Bioinformatically predicted

Overview

• Name: ssb
• Type: Machinery gene
• Locus tag: KQ257_RS14950
• Genome accession: NZ_CP076817
• Coordinates: 3104517..3104843 (+)
• Length: 108 a.a.
• NCBI ID: WP_002126519.1
• Uniprot ID: -
• Organism: Acinetobacter baumannii strain UC24137
• Function: ssDNA binding (predicted from homology) DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	3099027..3119638	3104517..3104843	within	0

Gene organization within MGE regions

Location: 3099027..3119638

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
KQ257_RS14910 (KQ257_14850)	-	3099027..3099749 (+)	723	WP_042052617.1	hypothetical protein	-
KQ257_RS14915 (KQ257_14855)	-	3099912..3100127 (+)	216	WP_020752871.1	hypothetical protein	-
KQ257_RS14920 (KQ257_14860)	-	3100131..3100349 (+)	219	WP_002124817.1	helix-turn-helix domain-containing protein	-
KQ257_RS14925 (KQ257_14865)	-	3100346..3100852 (+)	507	WP_077165694.1	BRO family protein	-
KQ257_RS14930 (KQ257_14870)	-	3100845..3101213 (+)	369	WP_038346496.1	hypothetical protein	-
KQ257_RS14935 (KQ257_14875)	-	3101223..3101555 (+)	333	WP_038346497.1	hypothetical protein	-
KQ257_RS14940 (KQ257_14880)	-	3101548..3101841 (+)	294	WP_020752874.1	hypothetical protein	-
KQ257_RS14945 (KQ257_14885)	-	3101834..3104263 (+)	2430	WP_253547008.1	DUF927 domain-containing protein	-
KQ257_RS14950 (KQ257_14890)	ssb	3104517..3104843 (+)	327	WP_002126519.1	single-stranded DNA-binding protein	Machinery gene
KQ257_RS14955 (KQ257_14895)	-	3106661..3107237 (+)	577	Protein_2901	class I SAM-dependent methyltransferase	-
KQ257_RS14960 (KQ257_14900)	-	3107230..3108237 (+)	1008	WP_004743506.1	HNH endonuclease signature motif containing protein	-
KQ257_RS14965 (KQ257_14905)	-	3108264..3108959 (-)	696	WP_004743507.1	SprT family zinc-dependent metalloprotease	-
KQ257_RS14970 (KQ257_14910)	-	3108956..3112036 (-)	3081	WP_046693189.1	HsdR family type I site-specific deoxyribonuclease	-
KQ257_RS14975 (KQ257_14915)	-	3112073..3113218 (-)	1146	WP_004743509.1	restriction endonuclease subunit S	-
KQ257_RS14980 (KQ257_14920)	-	3113215..3115938 (-)	2724	WP_004743510.1	class I SAM-dependent DNA methyltransferase	-
KQ257_RS14985 (KQ257_14925)	-	3116290..3117240 (+)	951	WP_004743511.1	hypothetical protein	-
KQ257_RS14990 (KQ257_14930)	-	3117370..3117654 (-)	285	WP_000675273.1	hypothetical protein	-
KQ257_RS14995 (KQ257_14935)	-	3118292..3119638 (-)	1347	WP_004743512.1	OprD family outer membrane porin	-

Sequence

Protein

• Length: 108 a.a.
• Molecular weight: 12234.94 Da
• Isoelectric Point: 10.2394

>NTDB_id=578253 KQ257_RS14950 WP_002126519.1 3104517..3104843(+) (ssb) [Acinetobacter baumannii strain UC24137]
MPNVNKVTVMGVLGRDPETKQFPNGGSVTTFSVATTEFWKDKTTGERKEATEWHRITTSNRLAEIASKYLKKGGKVYIEG
SLRTRKWKDSKGAEKEITEIRADEMQLL

Nucleotide

• Length: 327 bp

>NTDB_id=578253 KQ257_RS14950 WP_002126519.1 3104517..3104843(+) (ssb) [Acinetobacter baumannii strain UC24137]
ATGCCAAACGTAAACAAAGTAACTGTGATGGGTGTACTAGGTCGTGACCCTGAAACTAAACAATTTCCCAACGGCGGAAG
CGTTACCACATTCAGCGTTGCAACTACTGAGTTTTGGAAAGACAAGACTACAGGCGAGCGTAAAGAAGCTACAGAGTGGC
ATAGAATCACCACCAGCAACCGTTTAGCCGAGATTGCCAGTAAGTACCTCAAGAAAGGCGGAAAGGTGTATATCGAAGGC
TCATTGCGTACAAGGAAGTGGAAGGACAGCAAAGGGGCGGAAAAGGAAATAACCGAGATTCGAGCAGATGAGATGCAATT
GCTTTAA

Domains

Predicted by InterproScan.

• Single-strand binding protein family (SSB) (4-108)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
ssb	Glaesserella parasuis strain SC1401	55.556	100	0.556
ssb	Neisseria gonorrhoeae MS11	51.887	98.148	0.509
ssb	Neisseria meningitidis MC58	51.887	98.148	0.509
ssb	Vibrio cholerae strain A1552	54.639	89.815	0.491