Detailed information NTG0578206

Bioinformatically predicted

Overview

• Name: ssb
• Type: Machinery gene
• Locus tag: KQ256_RS18570
• Genome accession: NZ_CP076814
• Coordinates: 3875435..3875761 (+)
• Length: 108 a.a.
• NCBI ID: WP_002126519.1
• Uniprot ID: -
• Organism: Acinetobacter baumannii strain UC21460
• Function: ssDNA binding (predicted from homology) DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Prophage	3867526..3880229	3875435..3875761	within	0

Gene organization within MGE regions

Location: 3867526..3880229

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
KQ256_RS18520 (KQ256_18510)	-	3867526..3868782 (+)	1257	WP_004745119.1	tyrosine-type recombinase/integrase	-
KQ256_RS18525 (KQ256_18515)	-	3868854..3869714 (+)	861	WP_004745122.1	KilA-N domain-containing protein	-
KQ256_RS18530 (KQ256_18520)	-	3870432..3870668 (+)	237	WP_004745124.1	AlpA family transcriptional regulator	-
KQ256_RS18535 (KQ256_18525)	-	3870671..3870880 (+)	210	WP_004745125.1	helix-turn-helix domain-containing protein	-
KQ256_RS18540 (KQ256_18530)	-	3870877..3871386 (+)	510	WP_004745126.1	BRO family protein	-
KQ256_RS18545 (KQ256_18535)	-	3871379..3871747 (+)	369	WP_004745127.1	hypothetical protein	-
KQ256_RS18550 (KQ256_18540)	-	3871758..3872081 (+)	324	WP_004745129.1	hypothetical protein	-
KQ256_RS18555	-	3872090..3872473 (+)	384	WP_223235258.1	hypothetical protein	-
KQ256_RS18560 (KQ256_18550)	-	3872466..3872759 (+)	294	WP_004745131.1	hypothetical protein	-
KQ256_RS18565 (KQ256_18555)	-	3872752..3875181 (+)	2430	WP_004745132.1	DUF927 domain-containing protein	-
KQ256_RS18570 (KQ256_18560)	ssb	3875435..3875761 (+)	327	WP_002126519.1	single-stranded DNA-binding protein	Machinery gene
KQ256_RS18575 (KQ256_18565)	-	3876866..3877129 (-)	264	WP_000018128.1	metal/formaldehyde-sensitive transcriptional repressor	-
KQ256_RS18580 (KQ256_18570)	dmeF	3877187..3878179 (+)	993	WP_025466991.1	CDF family Co(II)/Ni(II) efflux transporter DmeF	-
KQ256_RS18585 (KQ256_18575)	-	3878275..3878973 (+)	699	WP_000592160.1	DsbC family protein	-
KQ256_RS18590 (KQ256_18580)	-	3879026..3879277 (-)	252	WP_000269732.1	GlsB/YeaQ/YmgE family stress response membrane protein	-
KQ256_RS18595 (KQ256_18585)	hpt	3879450..3879977 (-)	528	WP_000214980.1	hypoxanthine phosphoribosyltransferase	-

Sequence

Protein

• Length: 108 a.a.
• Molecular weight: 12234.94 Da
• Isoelectric Point: 10.2394

>NTDB_id=578206 KQ256_RS18570 WP_002126519.1 3875435..3875761(+) (ssb) [Acinetobacter baumannii strain UC21460]
MPNVNKVTVMGVLGRDPETKQFPNGGSVTTFSVATTEFWKDKTTGERKEATEWHRITTSNRLAEIASKYLKKGGKVYIEG
SLRTRKWKDSKGAEKEITEIRADEMQLL

Nucleotide

• Length: 327 bp

>NTDB_id=578206 KQ256_RS18570 WP_002126519.1 3875435..3875761(+) (ssb) [Acinetobacter baumannii strain UC21460]
ATGCCAAACGTAAACAAAGTAACTGTGATGGGTGTACTAGGTCGTGACCCTGAAACTAAACAATTTCCCAACGGCGGAAG
CGTTACCACATTCAGCGTTGCAACTACTGAGTTTTGGAAAGACAAGACTACAGGCGAGCGTAAAGAAGCTACAGAGTGGC
ATAGAATCACCACCAGCAACCGTTTAGCCGAGATTGCCAGTAAGTACCTCAAGAAAGGCGGAAAGGTGTATATCGAAGGC
TCATTGCGTACAAGGAAGTGGAAGGACAGCAAAGGGGCGGAAAAGGAAATAACCGAGATTCGAGCAGATGAGATGCAATT
GCTTTAA

Domains

Predicted by InterproScan.

• Single-strand binding protein family (SSB) (4-108)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
ssb	Glaesserella parasuis strain SC1401	55.556	100	0.556
ssb	Neisseria gonorrhoeae MS11	51.887	98.148	0.509
ssb	Neisseria meningitidis MC58	51.887	98.148	0.509
ssb	Vibrio cholerae strain A1552	54.639	89.815	0.491