Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   KPF51_RS04135 Genome accession   NZ_CP076656
Coordinates   919419..919871 (-) Length   150 a.a.
NCBI ID   WP_064702813.1    Uniprot ID   -
Organism   Pasteurella sp. XG20     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 912100..957403 919419..919871 within 0


Gene organization within MGE regions


Location: 912100..957403
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KPF51_RS04065 (KPF51_04065) - 912100..913131 (-) 1032 WP_064702826.1 tyrosine-type recombinase/integrase -
  KPF51_RS04070 (KPF51_04070) - 913133..913384 (-) 252 WP_052719234.1 DUF4224 domain-containing protein -
  KPF51_RS10815 - 913519..913989 (-) 471 WP_064702825.1 hypothetical protein -
  KPF51_RS04080 (KPF51_04080) - 913996..914262 (-) 267 WP_064702824.1 hypothetical protein -
  KPF51_RS04085 (KPF51_04085) - 914309..914614 (-) 306 WP_064702823.1 hypothetical protein -
  KPF51_RS04090 (KPF51_04090) - 914626..914859 (-) 234 WP_064702822.1 DUF551 domain-containing protein -
  KPF51_RS04095 (KPF51_04095) - 914868..915344 (-) 477 WP_064702821.1 hypothetical protein -
  KPF51_RS04100 (KPF51_04100) rdgC 915488..916396 (-) 909 WP_064702820.1 recombination-associated protein RdgC -
  KPF51_RS04105 (KPF51_04105) - 916427..916636 (-) 210 WP_064702819.1 hypothetical protein -
  KPF51_RS04110 (KPF51_04110) - 916712..917050 (-) 339 WP_064702818.1 hypothetical protein -
  KPF51_RS04115 (KPF51_04115) - 917037..917711 (-) 675 WP_064702817.1 hypothetical protein -
  KPF51_RS04120 (KPF51_04120) - 917742..918005 (-) 264 WP_064702816.1 hypothetical protein -
  KPF51_RS04125 (KPF51_04125) - 918055..918960 (-) 906 WP_064702815.1 SPFH domain-containing protein -
  KPF51_RS04130 (KPF51_04130) - 919211..919408 (-) 198 WP_064702814.1 hypothetical protein -
  KPF51_RS04135 (KPF51_04135) ssb 919419..919871 (-) 453 WP_064702813.1 single-stranded DNA-binding protein Machinery gene
  KPF51_RS04140 (KPF51_04140) - 919882..920583 (-) 702 WP_064702812.1 ERF family protein -
  KPF51_RS04145 (KPF51_04145) - 920626..921270 (-) 645 WP_064702811.1 ribonuclease H-like domain-containing protein -
  KPF51_RS04150 (KPF51_04150) - 921443..921655 (-) 213 WP_064702810.1 hypothetical protein -
  KPF51_RS04155 (KPF51_04155) - 921832..922113 (-) 282 WP_064702809.1 hypothetical protein -
  KPF51_RS04160 (KPF51_04160) - 922158..922799 (-) 642 WP_064702808.1 DUF3560 domain-containing protein -
  KPF51_RS04165 (KPF51_04165) - 922947..923174 (-) 228 WP_064702807.1 hypothetical protein -
  KPF51_RS04170 (KPF51_04170) - 923618..924520 (-) 903 WP_061406091.1 hypothetical protein -
  KPF51_RS04175 (KPF51_04175) - 924523..925131 (-) 609 WP_064702806.1 hypothetical protein -
  KPF51_RS04180 (KPF51_04180) - 925256..925942 (-) 687 WP_064702805.1 helix-turn-helix transcriptional regulator -
  KPF51_RS04185 (KPF51_04185) - 926064..926264 (+) 201 WP_064702804.1 YdaS family helix-turn-helix protein -
  KPF51_RS04190 (KPF51_04190) - 926313..926765 (+) 453 WP_014390720.1 phage regulatory CII family protein -
  KPF51_RS04195 (KPF51_04195) - 927002..927892 (+) 891 WP_081273046.1 replication protein -
  KPF51_RS04200 (KPF51_04200) - 927892..929328 (+) 1437 WP_064702803.1 DnaB-like helicase C-terminal domain-containing protein -
  KPF51_RS04205 (KPF51_04205) - 929332..929757 (+) 426 WP_064702802.1 recombination protein NinB -
  KPF51_RS04210 (KPF51_04210) - 929831..930031 (+) 201 WP_064702801.1 hypothetical protein -
  KPF51_RS04215 (KPF51_04215) - 930040..930282 (+) 243 WP_130555677.1 hypothetical protein -
  KPF51_RS04220 (KPF51_04220) - 930279..930434 (+) 156 WP_155736201.1 hypothetical protein -
  KPF51_RS04225 (KPF51_04225) - 930646..931227 (+) 582 WP_130555676.1 recombination protein NinG -
  KPF51_RS04230 (KPF51_04230) - 931224..931727 (+) 504 WP_064702797.1 antiterminator Q family protein -
  KPF51_RS04240 (KPF51_04240) - 932044..932340 (+) 297 WP_081273045.1 hypothetical protein -
  KPF51_RS04245 (KPF51_04245) - 932337..932867 (+) 531 WP_064702796.1 lysozyme -
  KPF51_RS04250 (KPF51_04250) - 932840..933163 (+) 324 WP_081273044.1 DUF2570 family protein -
  KPF51_RS04255 (KPF51_04255) - 933374..933742 (-) 369 WP_014391478.1 helix-turn-helix transcriptional regulator -
  KPF51_RS04260 (KPF51_04260) - 933779..934039 (-) 261 WP_064702795.1 type II toxin-antitoxin system RelE/ParE family toxin -
  KPF51_RS04265 (KPF51_04265) - 934245..934781 (+) 537 WP_064702794.1 terminase small subunit -
  KPF51_RS04270 (KPF51_04270) - 934765..935988 (+) 1224 WP_064702793.1 PBSX family phage terminase large subunit -
  KPF51_RS04275 (KPF51_04275) - 936003..937448 (+) 1446 WP_064702792.1 anti-CBASS protein Acb1 family protein -
  KPF51_RS04280 (KPF51_04280) - 937402..938373 (+) 972 WP_064702791.1 phage minor head protein -
  KPF51_RS04285 (KPF51_04285) - 938388..939734 (+) 1347 WP_064702790.1 DUF2213 domain-containing protein -
  KPF51_RS04290 (KPF51_04290) - 939734..940168 (+) 435 WP_064702789.1 hypothetical protein -
  KPF51_RS04295 (KPF51_04295) - 940180..941178 (+) 999 WP_064702788.1 major capsid protein -
  KPF51_RS04300 (KPF51_04300) - 941189..941575 (+) 387 WP_216711814.1 hypothetical protein -
  KPF51_RS10820 - 941556..941924 (+) 369 WP_064702786.1 hypothetical protein -
  KPF51_RS04310 (KPF51_04310) - 941927..942271 (+) 345 WP_064702785.1 hypothetical protein -
  KPF51_RS04315 (KPF51_04315) - 942276..942647 (+) 372 WP_064702784.1 hypothetical protein -
  KPF51_RS04320 (KPF51_04320) - 942644..943015 (+) 372 WP_064702783.1 hypothetical protein -
  KPF51_RS04325 (KPF51_04325) - 943027..943509 (+) 483 WP_014390749.1 phage tail tube protein -
  KPF51_RS04330 (KPF51_04330) - 943563..944234 (+) 672 WP_064702782.1 DUF6246 family protein -
  KPF51_RS04335 (KPF51_04335) - 944265..944729 (+) 465 WP_064702781.1 hypothetical protein -
  KPF51_RS04340 (KPF51_04340) - 944797..945192 (+) 396 WP_064702780.1 hypothetical protein -
  KPF51_RS04345 (KPF51_04345) - 945227..947686 (+) 2460 WP_253948821.1 phage tail length tape measure family protein -
  KPF51_RS04350 (KPF51_04350) - 947689..948018 (+) 330 WP_064702779.1 phage tail protein -
  KPF51_RS04355 (KPF51_04355) - 948037..948687 (+) 651 WP_064702778.1 phage minor tail protein L -
  KPF51_RS04360 (KPF51_04360) - 948689..949402 (+) 714 WP_064702777.1 C40 family peptidase -
  KPF51_RS04365 (KPF51_04365) - 949335..950060 (+) 726 WP_130555674.1 tail assembly protein -
  KPF51_RS04370 (KPF51_04370) - 950064..953711 (+) 3648 WP_064702776.1 host specificity protein J -
  KPF51_RS04375 (KPF51_04375) - 953723..955444 (+) 1722 WP_064702775.1 tail fiber protein -
  KPF51_RS04380 (KPF51_04380) - 955455..956042 (+) 588 WP_081106267.1 DUF4376 domain-containing protein -
  KPF51_RS04385 (KPF51_04385) - 956032..956289 (+) 258 WP_005725695.1 hypothetical protein -
  KPF51_RS04390 (KPF51_04390) - 956561..957403 (-) 843 WP_005726500.1 patatin family protein -

Sequence

Protein


Download         Length: 150 a.a.        Molecular weight: 16866.74 Da        Isoelectric Point: 6.9807

>NTDB_id=577061 KPF51_RS04135 WP_064702813.1 919419..919871(-) (ssb) [Pasteurella sp. XG20]
MAGVNLVIILGNLGNDPDIRTMPNGEAVAKISVATSESWIDKNTGERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
RLKTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQPQPQAQAPQNNAYANAKSGKPAQQAYSFEDDSIPF

Nucleotide


Download         Length: 453 bp        

>NTDB_id=577061 KPF51_RS04135 WP_064702813.1 919419..919871(-) (ssb) [Pasteurella sp. XG20]
ATGGCTGGGGTTAATCTTGTAATTATTTTAGGAAATTTAGGAAACGATCCTGATATCCGCACAATGCCAAATGGCGAAGC
AGTGGCAAAAATCAGCGTCGCAACTAGTGAAAGCTGGATTGATAAAAACACTGGCGAGCGCAAAACACAAACAGAATGGC
ACTCTATTGTGTTCTACCGTCGCCAAGCAGAAATTTGCGGTCAGTATCTCAAAAAAGGATCGAAAGTGTATGTGGAAGGG
CGTTTAAAAACTCGTAAGTGGCAAGACCAAAACGGGCAAGATCGCTACACAACTGAAATCCAAGGTGACGTATTGCAGAT
GTTAGACAGTCGCCAAGATTCGCAACCGCAACCGCAAGCACAGGCACCACAAAACAACGCTTATGCGAATGCGAAAAGTG
GAAAGCCAGCGCAACAGGCTTATAGTTTTGAAGATGATAGCATACCTTTTTAG

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(4-108)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

61.878

100

0.747
  ssb Vibrio cholerae strain A1552

53.521

94.667

0.507
  ssb Neisseria gonorrhoeae MS11

46.763

92.667

0.433
  ssb Neisseria meningitidis MC58

46.763

92.667

0.433