Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | KM147_RS06210 | Genome accession | NZ_CP076258 |
| Coordinates | 1397185..1397685 (-) | Length | 166 a.a. |
| NCBI ID | WP_198861207.1 | Uniprot ID | - |
| Organism | Providencia rettgeri strain W986 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1393254..1434422 | 1397185..1397685 | within | 0 |
Gene organization within MGE regions
Location: 1393254..1434422
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KM147_RS21075 (KM147_06180) | - | 1393254..1394300 (-) | 1047 | WP_198861204.1 | site-specific integrase | - |
| KM147_RS06185 (KM147_06185) | - | 1394502..1394747 (-) | 246 | WP_136134459.1 | hypothetical protein | - |
| KM147_RS06190 (KM147_06190) | - | 1394719..1394914 (-) | 196 | Protein_1198 | hypothetical protein | - |
| KM147_RS06195 (KM147_06195) | - | 1394922..1395554 (-) | 633 | WP_198861205.1 | MT-A70 family methyltransferase | - |
| KM147_RS06200 (KM147_06200) | - | 1395589..1396281 (-) | 693 | WP_136134462.1 | hypothetical protein | - |
| KM147_RS06205 (KM147_06205) | - | 1396351..1396884 (-) | 534 | WP_198861206.1 | hypothetical protein | - |
| KM147_RS06210 (KM147_06210) | ssb | 1397185..1397685 (-) | 501 | WP_198861207.1 | single-stranded DNA-binding protein | Machinery gene |
| KM147_RS06215 (KM147_06215) | - | 1397686..1398300 (-) | 615 | WP_198861208.1 | ERF family protein | - |
| KM147_RS06220 (KM147_06220) | exoX | 1398293..1398973 (-) | 681 | WP_282562948.1 | exodeoxyribonuclease X | - |
| KM147_RS06225 (KM147_06225) | - | 1398966..1399319 (-) | 354 | WP_198861210.1 | hypothetical protein | - |
| KM147_RS06230 (KM147_06230) | - | 1399312..1399464 (-) | 153 | WP_180312428.1 | hypothetical protein | - |
| KM147_RS21080 (KM147_06235) | - | 1399461..1399727 (-) | 267 | WP_048606419.1 | hypothetical protein | - |
| KM147_RS06240 (KM147_06240) | - | 1399949..1400860 (-) | 912 | WP_198861211.1 | cell envelope biogenesis protein TolA | - |
| KM147_RS06245 (KM147_06245) | - | 1400925..1401263 (-) | 339 | WP_198861212.1 | hypothetical protein | - |
| KM147_RS06250 (KM147_06250) | - | 1401265..1401531 (-) | 267 | WP_198861475.1 | hypothetical protein | - |
| KM147_RS06255 (KM147_06255) | - | 1401561..1402070 (-) | 510 | WP_198861213.1 | hypothetical protein | - |
| KM147_RS06260 (KM147_06260) | - | 1402441..1402640 (-) | 200 | Protein_1212 | antirestriction Ral family protein | - |
| KM147_RS06265 (KM147_06265) | - | 1403384..1403914 (-) | 531 | WP_215573065.1 | hypothetical protein | - |
| KM147_RS06270 (KM147_06270) | - | 1403898..1404191 (-) | 294 | WP_198861215.1 | hypothetical protein | - |
| KM147_RS20755 | - | 1404447..1404674 (-) | 228 | Protein_1215 | helix-turn-helix transcriptional regulator | - |
| KM147_RS06280 (KM147_06280) | - | 1404754..1404981 (+) | 228 | WP_164529029.1 | helix-turn-helix domain-containing protein | - |
| KM147_RS06285 (KM147_06285) | - | 1405087..1405431 (+) | 345 | WP_198861216.1 | hypothetical protein | - |
| KM147_RS06290 (KM147_06290) | - | 1405457..1405627 (+) | 171 | WP_166687390.1 | hypothetical protein | - |
| KM147_RS06295 (KM147_06295) | - | 1405617..1406540 (+) | 924 | WP_233102493.1 | replication protein | - |
| KM147_RS06300 (KM147_06300) | - | 1406543..1407913 (+) | 1371 | WP_198861217.1 | replicative DNA helicase | - |
| KM147_RS06305 (KM147_06305) | - | 1407939..1408190 (+) | 252 | WP_180312443.1 | hypothetical protein | - |
| KM147_RS06310 (KM147_06310) | - | 1408206..1408424 (+) | 219 | WP_198861218.1 | hypothetical protein | - |
| KM147_RS06315 (KM147_06315) | - | 1408500..1409165 (-) | 666 | WP_153673586.1 | DUF4145 domain-containing protein | - |
| KM147_RS06320 (KM147_06320) | - | 1409343..1409633 (+) | 291 | WP_198861219.1 | DUF4752 family protein | - |
| KM147_RS06325 (KM147_06325) | - | 1409643..1410086 (+) | 444 | WP_198861220.1 | YbcN family protein | - |
| KM147_RS06330 (KM147_06330) | - | 1410083..1410745 (+) | 663 | WP_198861221.1 | metallophosphoesterase | - |
| KM147_RS06335 (KM147_06335) | - | 1410806..1411096 (+) | 291 | WP_198861222.1 | DUF1364 domain-containing protein | - |
| KM147_RS06340 (KM147_06340) | - | 1411093..1411458 (+) | 366 | WP_198861223.1 | RusA family crossover junction endodeoxyribonuclease | - |
| KM147_RS06345 (KM147_06345) | - | 1411502..1411639 (+) | 138 | WP_333968788.1 | hypothetical protein | - |
| KM147_RS06350 (KM147_06350) | - | 1411636..1412247 (+) | 612 | WP_198861225.1 | hypothetical protein | - |
| KM147_RS06355 (KM147_06355) | - | 1412675..1412971 (+) | 297 | WP_198861226.1 | DUF4406 domain-containing protein | - |
| KM147_RS06360 (KM147_06360) | - | 1413074..1413391 (+) | 318 | WP_198861227.1 | phage holin, lambda family | - |
| KM147_RS06365 (KM147_06365) | - | 1413384..1413776 (+) | 393 | WP_198861228.1 | M15 family metallopeptidase | - |
| KM147_RS21085 (KM147_06370) | - | 1413773..1414105 (+) | 333 | WP_198861229.1 | DUF2570 family protein | - |
| KM147_RS06375 (KM147_06375) | - | 1414295..1414462 (+) | 168 | WP_198861230.1 | hypothetical protein | - |
| KM147_RS06380 (KM147_06380) | - | 1414493..1414858 (+) | 366 | WP_198861231.1 | Gp49 family protein | - |
| KM147_RS06385 (KM147_06385) | - | 1414932..1415159 (+) | 228 | WP_036964249.1 | DUF2560 family protein | - |
| KM147_RS06390 (KM147_06390) | - | 1415247..1415447 (+) | 201 | WP_198861232.1 | hypothetical protein | - |
| KM147_RS06395 (KM147_06395) | - | 1415531..1415947 (+) | 417 | WP_198861233.1 | DNA-packaging protein | - |
| KM147_RS06400 (KM147_06400) | - | 1415940..1417415 (+) | 1476 | WP_198861234.1 | PBSX family phage terminase large subunit | - |
| KM147_RS06405 (KM147_06405) | - | 1417418..1419619 (+) | 2202 | WP_198861235.1 | portal protein | - |
| KM147_RS06410 (KM147_06410) | - | 1419630..1420529 (+) | 900 | WP_198861236.1 | phage capsid protein | - |
| KM147_RS06415 (KM147_06415) | - | 1420544..1421815 (+) | 1272 | WP_198861237.1 | P22 phage major capsid protein family protein | - |
| KM147_RS06420 (KM147_06420) | - | 1421869..1422060 (+) | 192 | WP_198861238.1 | hypothetical protein | - |
| KM147_RS06425 (KM147_06425) | - | 1422041..1422523 (+) | 483 | WP_198861239.1 | packaged DNA stabilization gp4 family protein | - |
| KM147_RS21090 | - | 1422495..1424288 (+) | 1794 | WP_336431683.1 | packaged DNA stabilization protein | - |
| KM147_RS06440 (KM147_06440) | - | 1424288..1425007 (+) | 720 | WP_198861240.1 | phage tail protein | - |
| KM147_RS06445 (KM147_06445) | - | 1425007..1425471 (+) | 465 | WP_198861241.1 | DUF2824 family protein | - |
| KM147_RS06450 (KM147_06450) | - | 1425462..1426121 (+) | 660 | WP_198861242.1 | DNA transfer protein | - |
| KM147_RS06455 (KM147_06455) | - | 1426131..1427615 (+) | 1485 | WP_198861243.1 | phage DNA ejection protein | - |
| KM147_RS06460 (KM147_06460) | - | 1427627..1429588 (+) | 1962 | WP_198861244.1 | hypothetical protein | - |
| KM147_RS06465 (KM147_06465) | - | 1429612..1429962 (-) | 351 | WP_198861245.1 | Rap1a/Tai family immunity protein | - |
| KM147_RS06470 (KM147_06470) | - | 1429977..1430228 (-) | 252 | WP_109911150.1 | Arc family DNA-binding protein | - |
| KM147_RS20765 | - | 1430341..1432368 (+) | 2028 | WP_233102494.1 | phage head-binding domain-containing protein | - |
| KM147_RS06480 (KM147_06480) | - | 1432491..1434422 (-) | 1932 | WP_131681060.1 | type I secretion system permease/ATPase | - |
Sequence
Protein
Download Length: 166 a.a. Molecular weight: 18214.44 Da Isoelectric Point: 6.7202
>NTDB_id=574133 KM147_RS06210 WP_198861207.1 1397185..1397685(-) (ssb) [Providencia rettgeri strain W986]
MASKGVNKVILIGHLGQDPEIRYMPAGGAVANLTLATSESWRDKQSGEVRDKTEWHRVCIFGKLAEVAGEYLKKGSQVYI
EGSLQTRKWQDQSGQDRYTTEVVVNIGGSMQMLGGNGGNNQAGSQQPTRQPQQSQAPQNEPPMDFSDDIPFAPIGLPYPR
HAIYVI
MASKGVNKVILIGHLGQDPEIRYMPAGGAVANLTLATSESWRDKQSGEVRDKTEWHRVCIFGKLAEVAGEYLKKGSQVYI
EGSLQTRKWQDQSGQDRYTTEVVVNIGGSMQMLGGNGGNNQAGSQQPTRQPQQSQAPQNEPPMDFSDDIPFAPIGLPYPR
HAIYVI
Nucleotide
Download Length: 501 bp
>NTDB_id=574133 KM147_RS06210 WP_198861207.1 1397185..1397685(-) (ssb) [Providencia rettgeri strain W986]
ATGGCAAGTAAAGGCGTAAACAAGGTAATTCTCATTGGTCACTTAGGCCAAGACCCTGAAATTCGGTACATGCCAGCAGG
TGGCGCAGTAGCTAATCTCACACTGGCCACATCGGAATCGTGGCGTGATAAGCAATCGGGTGAAGTGCGCGATAAAACTG
AGTGGCATCGAGTATGCATCTTCGGCAAGTTAGCTGAAGTTGCAGGTGAATACCTGAAAAAAGGCTCACAAGTCTATATC
GAAGGTTCTTTACAGACGCGTAAATGGCAAGACCAAAGCGGTCAAGACCGATACACAACAGAAGTAGTGGTAAATATCGG
CGGCTCTATGCAAATGCTAGGCGGTAACGGTGGCAATAATCAGGCAGGAAGCCAGCAACCAACGCGACAACCTCAGCAGT
CACAAGCGCCGCAGAATGAGCCGCCTATGGACTTCTCGGATGATATCCCATTCGCTCCTATCGGGCTCCCCTACCCACGC
CACGCTATTTATGTGATTTAA
ATGGCAAGTAAAGGCGTAAACAAGGTAATTCTCATTGGTCACTTAGGCCAAGACCCTGAAATTCGGTACATGCCAGCAGG
TGGCGCAGTAGCTAATCTCACACTGGCCACATCGGAATCGTGGCGTGATAAGCAATCGGGTGAAGTGCGCGATAAAACTG
AGTGGCATCGAGTATGCATCTTCGGCAAGTTAGCTGAAGTTGCAGGTGAATACCTGAAAAAAGGCTCACAAGTCTATATC
GAAGGTTCTTTACAGACGCGTAAATGGCAAGACCAAAGCGGTCAAGACCGATACACAACAGAAGTAGTGGTAAATATCGG
CGGCTCTATGCAAATGCTAGGCGGTAACGGTGGCAATAATCAGGCAGGAAGCCAGCAACCAACGCGACAACCTCAGCAGT
CACAAGCGCCGCAGAATGAGCCGCCTATGGACTTCTCGGATGATATCCCATTCGCTCCTATCGGGCTCCCCTACCCACGC
CACGCTATTTATGTGATTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
67.797 |
100 |
0.723 |
| ssb | Glaesserella parasuis strain SC1401 |
51.381 |
100 |
0.56 |
| ssb | Neisseria meningitidis MC58 |
41.477 |
100 |
0.44 |
| ssb | Neisseria gonorrhoeae MS11 |
41.477 |
100 |
0.44 |