Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   KM132_RS12270 Genome accession   NZ_CP076119
Coordinates   2541388..2541765 (-) Length   125 a.a.
NCBI ID   WP_017418138.1    Uniprot ID   -
Organism   Bacillus velezensis strain NZ4     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2536388..2546765
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KM132_RS12230 (KM132_12230) - 2536885..2537679 (+) 795 WP_014418368.1 YqhG family protein -
  KM132_RS12235 (KM132_12235) sinI 2537856..2538029 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  KM132_RS12240 (KM132_12240) sinR 2538063..2538398 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  KM132_RS12245 (KM132_12245) tasA 2538446..2539231 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  KM132_RS12250 (KM132_12250) sipW 2539296..2539880 (-) 585 WP_012117977.1 signal peptidase I SipW -
  KM132_RS12255 (KM132_12255) tapA 2539852..2540523 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  KM132_RS12260 (KM132_12260) - 2540782..2541111 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  KM132_RS12265 (KM132_12265) - 2541152..2541331 (-) 180 WP_003153093.1 YqzE family protein -
  KM132_RS12270 (KM132_12270) comGG 2541388..2541765 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  KM132_RS12275 (KM132_12275) comGF 2541766..2542161 (-) 396 WP_154817562.1 competence type IV pilus minor pilin ComGF -
  KM132_RS12280 (KM132_12280) comGE 2542175..2542489 (-) 315 WP_021494312.1 competence type IV pilus minor pilin ComGE Machinery gene
  KM132_RS12285 (KM132_12285) comGD 2542473..2542910 (-) 438 WP_154817563.1 competence type IV pilus minor pilin ComGD Machinery gene
  KM132_RS12290 (KM132_12290) comGC 2542900..2543208 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  KM132_RS12295 (KM132_12295) comGB 2543213..2544250 (-) 1038 WP_154817564.1 competence type IV pilus assembly protein ComGB Machinery gene
  KM132_RS12300 (KM132_12300) comGA 2544237..2545307 (-) 1071 WP_154817565.1 competence type IV pilus ATPase ComGA Machinery gene
  KM132_RS12305 (KM132_12305) - 2545500..2546450 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14125.01 Da        Isoelectric Point: 9.7165

>NTDB_id=572113 KM132_RS12270 WP_017418138.1 2541388..2541765(-) (comGG) [Bacillus velezensis strain NZ4]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKGQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=572113 KM132_RS12270 WP_017418138.1 2541388..2541765(-) (comGG) [Bacillus velezensis strain NZ4]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGGCCAAACTGGTACACAGCGTTTTCCGTACGGCACCGTTTCT
TTTCACATCACCGGGAGTGATCGAAGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512