Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | KM132_RS12235 | Genome accession | NZ_CP076119 |
| Coordinates | 2537856..2538029 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus velezensis strain NZ4 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2532856..2543029
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KM132_RS12220 (KM132_12220) | gcvT | 2533669..2534769 (-) | 1101 | WP_021494308.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| KM132_RS12225 (KM132_12225) | - | 2535193..2536863 (+) | 1671 | WP_154817561.1 | SNF2-related protein | - |
| KM132_RS12230 (KM132_12230) | - | 2536885..2537679 (+) | 795 | WP_014418368.1 | YqhG family protein | - |
| KM132_RS12235 (KM132_12235) | sinI | 2537856..2538029 (+) | 174 | WP_014418369.1 | anti-repressor SinI | Regulator |
| KM132_RS12240 (KM132_12240) | sinR | 2538063..2538398 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| KM132_RS12245 (KM132_12245) | tasA | 2538446..2539231 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| KM132_RS12250 (KM132_12250) | sipW | 2539296..2539880 (-) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| KM132_RS12255 (KM132_12255) | tapA | 2539852..2540523 (-) | 672 | WP_014418371.1 | amyloid fiber anchoring/assembly protein TapA | - |
| KM132_RS12260 (KM132_12260) | - | 2540782..2541111 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| KM132_RS12265 (KM132_12265) | - | 2541152..2541331 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| KM132_RS12270 (KM132_12270) | comGG | 2541388..2541765 (-) | 378 | WP_017418138.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| KM132_RS12275 (KM132_12275) | comGF | 2541766..2542161 (-) | 396 | WP_154817562.1 | competence type IV pilus minor pilin ComGF | - |
| KM132_RS12280 (KM132_12280) | comGE | 2542175..2542489 (-) | 315 | WP_021494312.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| KM132_RS12285 (KM132_12285) | comGD | 2542473..2542910 (-) | 438 | WP_154817563.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=572111 KM132_RS12235 WP_014418369.1 2537856..2538029(+) (sinI) [Bacillus velezensis strain NZ4]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=572111 KM132_RS12235 WP_014418369.1 2537856..2538029(+) (sinI) [Bacillus velezensis strain NZ4]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |