Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   KM132_RS12235 Genome accession   NZ_CP076119
Coordinates   2537856..2538029 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain NZ4     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2532856..2543029
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KM132_RS12220 (KM132_12220) gcvT 2533669..2534769 (-) 1101 WP_021494308.1 glycine cleavage system aminomethyltransferase GcvT -
  KM132_RS12225 (KM132_12225) - 2535193..2536863 (+) 1671 WP_154817561.1 SNF2-related protein -
  KM132_RS12230 (KM132_12230) - 2536885..2537679 (+) 795 WP_014418368.1 YqhG family protein -
  KM132_RS12235 (KM132_12235) sinI 2537856..2538029 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  KM132_RS12240 (KM132_12240) sinR 2538063..2538398 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  KM132_RS12245 (KM132_12245) tasA 2538446..2539231 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  KM132_RS12250 (KM132_12250) sipW 2539296..2539880 (-) 585 WP_012117977.1 signal peptidase I SipW -
  KM132_RS12255 (KM132_12255) tapA 2539852..2540523 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  KM132_RS12260 (KM132_12260) - 2540782..2541111 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  KM132_RS12265 (KM132_12265) - 2541152..2541331 (-) 180 WP_003153093.1 YqzE family protein -
  KM132_RS12270 (KM132_12270) comGG 2541388..2541765 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  KM132_RS12275 (KM132_12275) comGF 2541766..2542161 (-) 396 WP_154817562.1 competence type IV pilus minor pilin ComGF -
  KM132_RS12280 (KM132_12280) comGE 2542175..2542489 (-) 315 WP_021494312.1 competence type IV pilus minor pilin ComGE Machinery gene
  KM132_RS12285 (KM132_12285) comGD 2542473..2542910 (-) 438 WP_154817563.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=572111 KM132_RS12235 WP_014418369.1 2537856..2538029(+) (sinI) [Bacillus velezensis strain NZ4]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=572111 KM132_RS12235 WP_014418369.1 2537856..2538029(+) (sinI) [Bacillus velezensis strain NZ4]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719