Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   KMZ33_RS01965 Genome accession   NZ_CP076113
Coordinates   412772..413224 (-) Length   150 a.a.
NCBI ID   WP_241951839.1    Uniprot ID   -
Organism   Pasteurella multocida strain GS2020-X2     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 405121..448616 412772..413224 within 0


Gene organization within MGE regions


Location: 405121..448616
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KMZ33_RS01910 - 405121..405783 (-) 663 WP_005726097.1 Bax inhibitor-1 family protein -
  KMZ33_RS01920 - 406126..407217 (-) 1092 WP_241951830.1 site-specific integrase -
  KMZ33_RS01925 - 407482..408321 (-) 840 WP_241951831.1 hypothetical protein -
  KMZ33_RS01930 - 408536..409339 (-) 804 WP_241951832.1 hypothetical protein -
  KMZ33_RS01935 - 409342..409797 (-) 456 WP_241951833.1 pyruvate kinase -
  KMZ33_RS01940 - 409855..410085 (-) 231 WP_241951834.1 hypothetical protein -
  KMZ33_RS01945 rdgC 410129..411037 (-) 909 WP_241951835.1 recombination-associated protein RdgC -
  KMZ33_RS01950 - 411116..411427 (-) 312 WP_241951836.1 DUF6378 domain-containing protein -
  KMZ33_RS01955 - 411424..411582 (-) 159 WP_241951837.1 hypothetical protein -
  KMZ33_RS01960 - 411648..412670 (-) 1023 WP_241951838.1 FRG domain-containing protein -
  KMZ33_RS01965 ssb 412772..413224 (-) 453 WP_241951839.1 single-stranded DNA-binding protein Machinery gene
  KMZ33_RS01970 - 413231..413842 (-) 612 WP_241951840.1 YqaJ viral recombinase family protein -
  KMZ33_RS01975 bet 413839..414627 (-) 789 WP_310549607.1 phage recombination protein Bet -
  KMZ33_RS01980 - 414636..415580 (-) 945 WP_241951841.1 hypothetical protein -
  KMZ33_RS01985 - 415730..415972 (-) 243 WP_241951842.1 hypothetical protein -
  KMZ33_RS01990 - 415959..416237 (-) 279 WP_241951843.1 hypothetical protein -
  KMZ33_RS01995 - 416282..416923 (-) 642 WP_241951844.1 DUF3560 domain-containing protein -
  KMZ33_RS02000 - 417487..418152 (-) 666 WP_241951845.1 S24 family peptidase -
  KMZ33_RS02005 - 418267..418482 (+) 216 WP_241951846.1 helix-turn-helix domain-containing protein -
  KMZ33_RS02010 - 418541..419242 (+) 702 WP_241951847.1 phage regulatory protein/antirepressor Ant -
  KMZ33_RS02015 - 419242..420084 (+) 843 WP_241951848.1 replication protein -
  KMZ33_RS02020 - 420084..420770 (+) 687 WP_241951849.1 replication protein P -
  KMZ33_RS02025 - 420952..421488 (+) 537 WP_241951850.1 phage N-6-adenine-methyltransferase -
  KMZ33_RS02030 - 421478..421894 (+) 417 WP_241951851.1 recombination protein NinB -
  KMZ33_RS02035 - 421912..422151 (+) 240 WP_241951852.1 hypothetical protein -
  KMZ33_RS02040 - 422155..422382 (+) 228 WP_241951853.1 hypothetical protein -
  KMZ33_RS02045 - 422375..422953 (+) 579 WP_241951854.1 recombination protein NinG -
  KMZ33_RS02050 - 422950..423453 (+) 504 WP_241951855.1 antiterminator Q family protein -
  KMZ33_RS02055 - 423590..423838 (+) 249 WP_241951856.1 hypothetical protein -
  KMZ33_RS02060 - 423825..424367 (+) 543 WP_241951857.1 lysozyme -
  KMZ33_RS02065 - 424340..424663 (+) 324 WP_241951858.1 DUF2570 family protein -
  KMZ33_RS02070 - 424888..425304 (-) 417 WP_241951859.1 type II toxin-antitoxin system HicB family antitoxin -
  KMZ33_RS02075 - 425350..425529 (-) 180 WP_277883190.1 type II toxin-antitoxin system HicA family toxin -
  KMZ33_RS02080 - 425783..426247 (+) 465 WP_241951860.1 DUF1441 family protein -
  KMZ33_RS02085 - 426262..428367 (+) 2106 WP_241951861.1 phage terminase large subunit family protein -
  KMZ33_RS02090 - 428358..428582 (+) 225 WP_241951862.1 hypothetical protein -
  KMZ33_RS02095 - 428582..430120 (+) 1539 WP_241951863.1 phage portal protein -
  KMZ33_RS02100 - 430056..432044 (+) 1989 WP_241951864.1 ClpP-like prohead protease/major capsid protein fusion protein -
  KMZ33_RS02105 - 432114..432440 (+) 327 WP_241951865.1 capsid cement protein -
  KMZ33_RS02110 - 432433..432726 (+) 294 WP_241951866.1 hypothetical protein -
  KMZ33_RS02115 - 432726..433277 (+) 552 WP_241951867.1 phage tail protein -
  KMZ33_RS02120 - 433274..433678 (+) 405 WP_241951868.1 phage minor tail U family protein -
  KMZ33_RS02125 - 433678..434193 (+) 516 WP_241951869.1 phage tail tube protein -
  KMZ33_RS02130 - 434196..434579 (+) 384 WP_241951870.1 phage minor tail protein G -
  KMZ33_RS02135 - 434654..434902 (+) 249 WP_241951871.1 phage tail assembly protein T -
  KMZ33_RS02140 - 434889..435152 (+) 264 WP_241951872.1 hypothetical protein -
  KMZ33_RS02145 - 435168..437261 (+) 2094 Protein_405 hypothetical protein -
  KMZ33_RS02150 - 437264..437611 (+) 348 WP_241951874.1 phage tail protein -
  KMZ33_RS02155 - 437686..438195 (+) 510 WP_241951875.1 hypothetical protein -
  KMZ33_RS02160 - 438254..438964 (+) 711 WP_241951876.1 phage minor tail protein L -
  KMZ33_RS02165 - 438967..439704 (+) 738 WP_241951877.1 C40 family peptidase -
  KMZ33_RS02170 - 439647..440267 (+) 621 WP_241951878.1 tail assembly protein -
  KMZ33_RS02175 - 440271..445274 (+) 5004 WP_241951879.1 phage tail protein -
  KMZ33_RS02180 - 445322..445648 (+) 327 WP_241951880.1 hypothetical protein -
  KMZ33_RS02185 - 445905..446528 (+) 624 WP_241951881.1 hypothetical protein -
  KMZ33_RS02190 - 446702..447214 (-) 513 WP_241951882.1 hypothetical protein -
  KMZ33_RS02195 fdhE 447687..448616 (-) 930 WP_241952310.1 formate dehydrogenase accessory protein FdhE -

Sequence

Protein


Download         Length: 150 a.a.        Molecular weight: 17047.95 Da        Isoelectric Point: 5.2868

>NTDB_id=571946 KMZ33_RS01965 WP_241951839.1 412772..413224(-) (ssb) [Pasteurella multocida strain GS2020-X2]
MAGVNKVIIVGNLGNDPEIRTMPNGDLVANISVATSESWIDKNTNERKEVTEWHSIMFYRRQAEICEKYLKKGSKVYVEG
KLKTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQPQQAQAPQNNPYANAKAGKPAQQQADSFEDDNIPF

Nucleotide


Download         Length: 453 bp        

>NTDB_id=571946 KMZ33_RS01965 WP_241951839.1 412772..413224(-) (ssb) [Pasteurella multocida strain GS2020-X2]
GTGGCTGGAGTAAATAAAGTAATTATCGTGGGAAATTTGGGAAACGATCCTGAAATCCGCACCATGCCAAATGGCGACCT
TGTAGCAAATATTAGTGTGGCGACAAGTGAAAGCTGGATTGATAAAAACACGAACGAACGTAAAGAAGTGACCGAGTGGC
ACTCTATTATGTTTTATCGCAGACAAGCAGAGATTTGCGAGAAGTACCTCAAAAAAGGATCTAAAGTCTATGTTGAGGGG
AAACTGAAAACACGCAAATGGCAAGACCAAAACGGACAAGATCGCTACACAACTGAAATCCAAGGTGACGTGTTGCAGAT
GTTAGACAGTCGCCAAGATTCGCAACCGCAGCAAGCACAAGCACCGCAAAACAATCCTTATGCGAATGCGAAAGCTGGAA
AGCCAGCACAGCAACAAGCAGATAGCTTTGAAGACGACAATATACCGTTCTGA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(4-108)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

63.536

100

0.767
  ssb Vibrio cholerae strain A1552

54.676

92.667

0.507
  ssb Neisseria gonorrhoeae MS11

45.985

91.333

0.42
  ssb Neisseria meningitidis MC58

45.985

91.333

0.42