Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   G8O87_RS11145 Genome accession   NZ_CP075878
Coordinates   2188333..2188869 (-) Length   178 a.a.
NCBI ID   WP_003721668.1    Uniprot ID   A0A0E0USV6
Organism   Listeria monocytogenes strain 2HF33     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2136284..2188869 2188333..2188869 within 0


Gene organization within MGE regions


Location: 2136284..2188869
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  G8O87_RS10835 - 2136284..2137435 (-) 1152 WP_014930665.1 site-specific integrase -
  G8O87_RS10840 - 2137457..2138170 (-) 714 WP_014930666.1 lipoprotein -
  G8O87_RS10845 - 2138225..2138725 (-) 501 WP_014930667.1 ImmA/IrrE family metallo-endopeptidase -
  G8O87_RS10850 - 2138738..2139064 (-) 327 WP_012951299.1 helix-turn-helix domain-containing protein -
  G8O87_RS10855 - 2139238..2139429 (+) 192 WP_014930668.1 helix-turn-helix transcriptional regulator -
  G8O87_RS10860 - 2139527..2139853 (+) 327 WP_012951301.1 DUF771 domain-containing protein -
  G8O87_RS10865 - 2140026..2141066 (+) 1041 WP_014930669.1 conserved phage C-terminal domain-containing protein -
  G8O87_RS10870 - 2141068..2141424 (+) 357 WP_014930670.1 phage terminase small subunit-related protein -
  G8O87_RS10875 - 2141421..2141822 (+) 402 WP_014930671.1 hypothetical protein -
  G8O87_RS10880 - 2141835..2142011 (+) 177 WP_014930672.1 hypothetical protein -
  G8O87_RS10885 - 2142025..2142549 (+) 525 WP_031670005.1 hypothetical protein -
  G8O87_RS10890 - 2142558..2143022 (+) 465 WP_014930674.1 class I SAM-dependent methyltransferase -
  G8O87_RS10895 - 2143019..2143579 (+) 561 WP_014601511.1 DUF1642 domain-containing protein -
  G8O87_RS10900 - 2143576..2143722 (+) 147 WP_014929526.1 hypothetical protein -
  G8O87_RS10905 - 2143800..2144201 (+) 402 WP_014601510.1 hypothetical protein -
  G8O87_RS10910 - 2144198..2144407 (+) 210 WP_014601509.1 hypothetical protein -
  G8O87_RS10915 - 2144586..2144912 (+) 327 WP_014930675.1 hypothetical protein -
  G8O87_RS10920 ssbA 2144909..2145388 (+) 480 WP_014930676.1 single-stranded DNA-binding protein Machinery gene
  G8O87_RS10925 - 2145457..2145633 (+) 177 WP_223196704.1 hypothetical protein -
  G8O87_RS10930 - 2145694..2146212 (+) 519 WP_014930677.1 sigma factor-like helix-turn-helix DNA-binding protein -
  G8O87_RS10935 - 2146209..2146751 (+) 543 WP_012951317.1 tyrosine-type recombinase/integrase -
  G8O87_RS10940 - 2146767..2147105 (+) 339 WP_014930678.1 hypothetical protein -
  G8O87_RS10945 - 2147370..2147696 (+) 327 WP_014930679.1 hypothetical protein -
  G8O87_RS16020 - 2147693..2148055 (+) 363 WP_052199047.1 HNH endonuclease signature motif containing protein -
  G8O87_RS10955 - 2148150..2148677 (+) 528 WP_012951321.1 phage terminase small subunit P27 family -
  G8O87_RS10960 - 2148670..2150397 (+) 1728 WP_031669999.1 terminase large subunit -
  G8O87_RS10965 - 2150404..2150604 (+) 201 WP_031669998.1 DUF1056 family protein -
  G8O87_RS10970 - 2150607..2151842 (+) 1236 WP_031669997.1 phage portal protein -
  G8O87_RS10975 - 2151839..2152405 (+) 567 WP_049955709.1 HK97 family phage prohead protease -
  G8O87_RS10980 - 2152470..2153639 (+) 1170 WP_049955708.1 phage major capsid protein -
  G8O87_RS10985 - 2153688..2154026 (+) 339 WP_012951326.1 head-tail connector protein -
  G8O87_RS10990 - 2153996..2154316 (+) 321 WP_031669990.1 phage head closure protein -
  G8O87_RS10995 - 2154310..2154675 (+) 366 WP_031669989.1 HK97-gp10 family putative phage morphogenesis protein -
  G8O87_RS11000 - 2154679..2155077 (+) 399 WP_031669988.1 hypothetical protein -
  G8O87_RS11005 - 2155098..2155673 (+) 576 WP_031669987.1 major tail protein -
  G8O87_RS11010 gpG 2155763..2156110 (+) 348 WP_031669986.1 phage tail assembly chaperone G -
  G8O87_RS11015 - 2156125..2156289 (+) 165 WP_158231546.1 hypothetical protein -
  G8O87_RS11020 - 2156307..2160506 (+) 4200 WP_031669985.1 phage tail tape measure protein -
  G8O87_RS11025 - 2160499..2162742 (+) 2244 WP_014930683.1 distal tail protein Dit -
  G8O87_RS11030 - 2162748..2165039 (+) 2292 WP_031668916.1 phage tail spike protein -
  G8O87_RS11035 - 2165032..2166105 (+) 1074 WP_256735811.1 hypothetical protein -
  G8O87_RS11040 - 2166009..2166395 (-) 387 Protein_2179 ribonuclease YeeF family protein -
  G8O87_RS11045 - 2166409..2166741 (-) 333 WP_009912885.1 hypothetical protein -
  G8O87_RS11050 - 2166742..2167443 (-) 702 WP_010989331.1 DUF5081 family protein -
  G8O87_RS11055 - 2167440..2167739 (-) 300 WP_003727546.1 WXG100 family type VII secretion target -
  G8O87_RS11060 - 2167732..2168127 (-) 396 WP_031669056.1 hypothetical protein -
  G8O87_RS11065 essC 2168147..2172643 (-) 4497 WP_031669055.1 type VII secretion protein EssC -
  G8O87_RS11070 essB 2172657..2173853 (-) 1197 WP_003724888.1 type VII secretion protein EssB -
  G8O87_RS11075 - 2173875..2174126 (-) 252 WP_003721683.1 EsaB/YukD family protein -
  G8O87_RS11080 essA 2174144..2174659 (-) 516 WP_003732193.1 type VII secretion protein EssA -
  G8O87_RS11085 esaA 2174649..2177855 (-) 3207 WP_031669054.1 type VII secretion protein EsaA -
  G8O87_RS11090 - 2178004..2178297 (-) 294 WP_003721680.1 WXG100 family type VII secretion target -
  G8O87_RS11095 - 2178614..2179906 (-) 1293 WP_003721679.1 adenylosuccinate synthase -
  G8O87_RS11100 dnaB 2180165..2181517 (-) 1353 WP_003721677.1 replicative DNA helicase -
  G8O87_RS11105 rplI 2181542..2181988 (-) 447 WP_003721676.1 50S ribosomal protein L9 -
  G8O87_RS11110 pdeA 2181991..2183964 (-) 1974 WP_003721675.1 cyclic-di-AMP phosphodiesterase PdeA -
  G8O87_RS11115 - 2184131..2184859 (-) 729 WP_003721674.1 LytTR family DNA-binding domain-containing protein -
  G8O87_RS11120 - 2184878..2186173 (-) 1296 WP_003721673.1 sensor histidine kinase -
  G8O87_RS11125 - 2186269..2186430 (-) 162 WP_003721672.1 cyclic lactone autoinducer peptide -
  G8O87_RS11130 - 2186414..2187028 (-) 615 WP_003727551.1 accessory gene regulator ArgB-like protein -
  G8O87_RS11135 - 2187285..2187896 (-) 612 WP_003721670.1 PepSY domain-containing protein -
  G8O87_RS11140 rpsR 2188050..2188289 (-) 240 WP_003721669.1 30S ribosomal protein S18 -
  G8O87_RS11145 ssbA 2188333..2188869 (-) 537 WP_003721668.1 single-stranded DNA-binding protein Machinery gene

Sequence


Protein


Download         Length: 178 a.a.        Molecular weight: 19493.14 Da        Isoelectric Point: 4.7306

>NTDB_id=570656 G8O87_RS11145 WP_003721668.1 2188333..2188869(-) (ssbA) [Listeria monocytogenes strain 2HF33]
MMNRVVLVGRLTKDPELRYTPAGVAVATFTLAVNRTFTNQQGEREADFINCVVWRKPAENVANFLKKGSMAGVDGRVQTR
NYEGNDGKRVYVTEIVAESVQFLEPRNSNGGGGNNYQSGNNNNNYNSGGNNFGQAPTNNGGFGQDQQQSQNQNYQSTNND
PFASDGKPIDISDDDLPF

Nucleotide


Download         Length: 537 bp        

>NTDB_id=570656 G8O87_RS11145 WP_003721668.1 2188333..2188869(-) (ssbA) [Listeria monocytogenes strain 2HF33]
ATGATGAATCGTGTAGTACTTGTAGGACGCTTAACAAAAGATCCTGAATTACGTTACACTCCAGCTGGTGTGGCTGTTGC
GACTTTTACATTAGCTGTAAATCGCACTTTCACTAACCAACAAGGAGAACGAGAAGCTGACTTTATTAATTGTGTTGTTT
GGCGTAAACCGGCAGAAAACGTTGCTAATTTCCTGAAGAAGGGAAGCATGGCGGGCGTTGATGGCCGTGTTCAAACTCGT
AATTACGAGGGAAACGACGGTAAACGTGTTTATGTGACTGAAATTGTAGCAGAGAGTGTTCAATTCCTTGAACCGCGTAA
TTCTAATGGCGGTGGCGGAAATAACTATCAAAGTGGCAATAACAACAATAATTACAATAGCGGTGGAAATAACTTCGGAC
AAGCACCTACAAATAACGGTGGATTCGGACAGGACCAGCAACAATCTCAAAATCAAAATTATCAATCCACTAATAATGAT
CCTTTTGCAAGTGATGGTAAGCCAATCGACATTTCTGATGACGATTTGCCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0E0USV6

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

68.539

100

0.685

  ssb Latilactobacillus sakei subsp. sakei 23K

55.618

100

0.556

  ssb Glaesserella parasuis strain SC1401

35.484

100

0.371

  ssbB Bacillus subtilis subsp. subtilis str. 168

61.321

59.551

0.365