Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | G8O87_RS11145 | Genome accession | NZ_CP075878 |
| Coordinates | 2188333..2188869 (-) | Length | 178 a.a. |
| NCBI ID | WP_003721668.1 | Uniprot ID | A0A0E0USV6 |
| Organism | Listeria monocytogenes strain 2HF33 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2136284..2188869 | 2188333..2188869 | within | 0 |
Gene organization within MGE regions
Location: 2136284..2188869
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G8O87_RS10835 | - | 2136284..2137435 (-) | 1152 | WP_014930665.1 | site-specific integrase | - |
| G8O87_RS10840 | - | 2137457..2138170 (-) | 714 | WP_014930666.1 | lipoprotein | - |
| G8O87_RS10845 | - | 2138225..2138725 (-) | 501 | WP_014930667.1 | ImmA/IrrE family metallo-endopeptidase | - |
| G8O87_RS10850 | - | 2138738..2139064 (-) | 327 | WP_012951299.1 | helix-turn-helix domain-containing protein | - |
| G8O87_RS10855 | - | 2139238..2139429 (+) | 192 | WP_014930668.1 | helix-turn-helix transcriptional regulator | - |
| G8O87_RS10860 | - | 2139527..2139853 (+) | 327 | WP_012951301.1 | DUF771 domain-containing protein | - |
| G8O87_RS10865 | - | 2140026..2141066 (+) | 1041 | WP_014930669.1 | conserved phage C-terminal domain-containing protein | - |
| G8O87_RS10870 | - | 2141068..2141424 (+) | 357 | WP_014930670.1 | phage terminase small subunit-related protein | - |
| G8O87_RS10875 | - | 2141421..2141822 (+) | 402 | WP_014930671.1 | hypothetical protein | - |
| G8O87_RS10880 | - | 2141835..2142011 (+) | 177 | WP_014930672.1 | hypothetical protein | - |
| G8O87_RS10885 | - | 2142025..2142549 (+) | 525 | WP_031670005.1 | hypothetical protein | - |
| G8O87_RS10890 | - | 2142558..2143022 (+) | 465 | WP_014930674.1 | class I SAM-dependent methyltransferase | - |
| G8O87_RS10895 | - | 2143019..2143579 (+) | 561 | WP_014601511.1 | DUF1642 domain-containing protein | - |
| G8O87_RS10900 | - | 2143576..2143722 (+) | 147 | WP_014929526.1 | hypothetical protein | - |
| G8O87_RS10905 | - | 2143800..2144201 (+) | 402 | WP_014601510.1 | hypothetical protein | - |
| G8O87_RS10910 | - | 2144198..2144407 (+) | 210 | WP_014601509.1 | hypothetical protein | - |
| G8O87_RS10915 | - | 2144586..2144912 (+) | 327 | WP_014930675.1 | hypothetical protein | - |
| G8O87_RS10920 | ssbA | 2144909..2145388 (+) | 480 | WP_014930676.1 | single-stranded DNA-binding protein | Machinery gene |
| G8O87_RS10925 | - | 2145457..2145633 (+) | 177 | WP_223196704.1 | hypothetical protein | - |
| G8O87_RS10930 | - | 2145694..2146212 (+) | 519 | WP_014930677.1 | sigma factor-like helix-turn-helix DNA-binding protein | - |
| G8O87_RS10935 | - | 2146209..2146751 (+) | 543 | WP_012951317.1 | tyrosine-type recombinase/integrase | - |
| G8O87_RS10940 | - | 2146767..2147105 (+) | 339 | WP_014930678.1 | hypothetical protein | - |
| G8O87_RS10945 | - | 2147370..2147696 (+) | 327 | WP_014930679.1 | hypothetical protein | - |
| G8O87_RS16020 | - | 2147693..2148055 (+) | 363 | WP_052199047.1 | HNH endonuclease signature motif containing protein | - |
| G8O87_RS10955 | - | 2148150..2148677 (+) | 528 | WP_012951321.1 | phage terminase small subunit P27 family | - |
| G8O87_RS10960 | - | 2148670..2150397 (+) | 1728 | WP_031669999.1 | terminase large subunit | - |
| G8O87_RS10965 | - | 2150404..2150604 (+) | 201 | WP_031669998.1 | DUF1056 family protein | - |
| G8O87_RS10970 | - | 2150607..2151842 (+) | 1236 | WP_031669997.1 | phage portal protein | - |
| G8O87_RS10975 | - | 2151839..2152405 (+) | 567 | WP_049955709.1 | HK97 family phage prohead protease | - |
| G8O87_RS10980 | - | 2152470..2153639 (+) | 1170 | WP_049955708.1 | phage major capsid protein | - |
| G8O87_RS10985 | - | 2153688..2154026 (+) | 339 | WP_012951326.1 | head-tail connector protein | - |
| G8O87_RS10990 | - | 2153996..2154316 (+) | 321 | WP_031669990.1 | phage head closure protein | - |
| G8O87_RS10995 | - | 2154310..2154675 (+) | 366 | WP_031669989.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| G8O87_RS11000 | - | 2154679..2155077 (+) | 399 | WP_031669988.1 | hypothetical protein | - |
| G8O87_RS11005 | - | 2155098..2155673 (+) | 576 | WP_031669987.1 | major tail protein | - |
| G8O87_RS11010 | gpG | 2155763..2156110 (+) | 348 | WP_031669986.1 | phage tail assembly chaperone G | - |
| G8O87_RS11015 | - | 2156125..2156289 (+) | 165 | WP_158231546.1 | hypothetical protein | - |
| G8O87_RS11020 | - | 2156307..2160506 (+) | 4200 | WP_031669985.1 | phage tail tape measure protein | - |
| G8O87_RS11025 | - | 2160499..2162742 (+) | 2244 | WP_014930683.1 | distal tail protein Dit | - |
| G8O87_RS11030 | - | 2162748..2165039 (+) | 2292 | WP_031668916.1 | phage tail spike protein | - |
| G8O87_RS11035 | - | 2165032..2166105 (+) | 1074 | WP_256735811.1 | hypothetical protein | - |
| G8O87_RS11040 | - | 2166009..2166395 (-) | 387 | Protein_2179 | ribonuclease YeeF family protein | - |
| G8O87_RS11045 | - | 2166409..2166741 (-) | 333 | WP_009912885.1 | hypothetical protein | - |
| G8O87_RS11050 | - | 2166742..2167443 (-) | 702 | WP_010989331.1 | DUF5081 family protein | - |
| G8O87_RS11055 | - | 2167440..2167739 (-) | 300 | WP_003727546.1 | WXG100 family type VII secretion target | - |
| G8O87_RS11060 | - | 2167732..2168127 (-) | 396 | WP_031669056.1 | hypothetical protein | - |
| G8O87_RS11065 | essC | 2168147..2172643 (-) | 4497 | WP_031669055.1 | type VII secretion protein EssC | - |
| G8O87_RS11070 | essB | 2172657..2173853 (-) | 1197 | WP_003724888.1 | type VII secretion protein EssB | - |
| G8O87_RS11075 | - | 2173875..2174126 (-) | 252 | WP_003721683.1 | EsaB/YukD family protein | - |
| G8O87_RS11080 | essA | 2174144..2174659 (-) | 516 | WP_003732193.1 | type VII secretion protein EssA | - |
| G8O87_RS11085 | esaA | 2174649..2177855 (-) | 3207 | WP_031669054.1 | type VII secretion protein EsaA | - |
| G8O87_RS11090 | - | 2178004..2178297 (-) | 294 | WP_003721680.1 | WXG100 family type VII secretion target | - |
| G8O87_RS11095 | - | 2178614..2179906 (-) | 1293 | WP_003721679.1 | adenylosuccinate synthase | - |
| G8O87_RS11100 | dnaB | 2180165..2181517 (-) | 1353 | WP_003721677.1 | replicative DNA helicase | - |
| G8O87_RS11105 | rplI | 2181542..2181988 (-) | 447 | WP_003721676.1 | 50S ribosomal protein L9 | - |
| G8O87_RS11110 | pdeA | 2181991..2183964 (-) | 1974 | WP_003721675.1 | cyclic-di-AMP phosphodiesterase PdeA | - |
| G8O87_RS11115 | - | 2184131..2184859 (-) | 729 | WP_003721674.1 | LytTR family DNA-binding domain-containing protein | - |
| G8O87_RS11120 | - | 2184878..2186173 (-) | 1296 | WP_003721673.1 | sensor histidine kinase | - |
| G8O87_RS11125 | - | 2186269..2186430 (-) | 162 | WP_003721672.1 | cyclic lactone autoinducer peptide | - |
| G8O87_RS11130 | - | 2186414..2187028 (-) | 615 | WP_003727551.1 | accessory gene regulator ArgB-like protein | - |
| G8O87_RS11135 | - | 2187285..2187896 (-) | 612 | WP_003721670.1 | PepSY domain-containing protein | - |
| G8O87_RS11140 | rpsR | 2188050..2188289 (-) | 240 | WP_003721669.1 | 30S ribosomal protein S18 | - |
| G8O87_RS11145 | ssbA | 2188333..2188869 (-) | 537 | WP_003721668.1 | single-stranded DNA-binding protein | Machinery gene |
Sequence
Protein
Download Length: 178 a.a. Molecular weight: 19493.14 Da Isoelectric Point: 4.7306
>NTDB_id=570656 G8O87_RS11145 WP_003721668.1 2188333..2188869(-) (ssbA) [Listeria monocytogenes strain 2HF33]
MMNRVVLVGRLTKDPELRYTPAGVAVATFTLAVNRTFTNQQGEREADFINCVVWRKPAENVANFLKKGSMAGVDGRVQTR
NYEGNDGKRVYVTEIVAESVQFLEPRNSNGGGGNNYQSGNNNNNYNSGGNNFGQAPTNNGGFGQDQQQSQNQNYQSTNND
PFASDGKPIDISDDDLPF
MMNRVVLVGRLTKDPELRYTPAGVAVATFTLAVNRTFTNQQGEREADFINCVVWRKPAENVANFLKKGSMAGVDGRVQTR
NYEGNDGKRVYVTEIVAESVQFLEPRNSNGGGGNNYQSGNNNNNYNSGGNNFGQAPTNNGGFGQDQQQSQNQNYQSTNND
PFASDGKPIDISDDDLPF
Nucleotide
Download Length: 537 bp
>NTDB_id=570656 G8O87_RS11145 WP_003721668.1 2188333..2188869(-) (ssbA) [Listeria monocytogenes strain 2HF33]
ATGATGAATCGTGTAGTACTTGTAGGACGCTTAACAAAAGATCCTGAATTACGTTACACTCCAGCTGGTGTGGCTGTTGC
GACTTTTACATTAGCTGTAAATCGCACTTTCACTAACCAACAAGGAGAACGAGAAGCTGACTTTATTAATTGTGTTGTTT
GGCGTAAACCGGCAGAAAACGTTGCTAATTTCCTGAAGAAGGGAAGCATGGCGGGCGTTGATGGCCGTGTTCAAACTCGT
AATTACGAGGGAAACGACGGTAAACGTGTTTATGTGACTGAAATTGTAGCAGAGAGTGTTCAATTCCTTGAACCGCGTAA
TTCTAATGGCGGTGGCGGAAATAACTATCAAAGTGGCAATAACAACAATAATTACAATAGCGGTGGAAATAACTTCGGAC
AAGCACCTACAAATAACGGTGGATTCGGACAGGACCAGCAACAATCTCAAAATCAAAATTATCAATCCACTAATAATGAT
CCTTTTGCAAGTGATGGTAAGCCAATCGACATTTCTGATGACGATTTGCCATTCTAA
ATGATGAATCGTGTAGTACTTGTAGGACGCTTAACAAAAGATCCTGAATTACGTTACACTCCAGCTGGTGTGGCTGTTGC
GACTTTTACATTAGCTGTAAATCGCACTTTCACTAACCAACAAGGAGAACGAGAAGCTGACTTTATTAATTGTGTTGTTT
GGCGTAAACCGGCAGAAAACGTTGCTAATTTCCTGAAGAAGGGAAGCATGGCGGGCGTTGATGGCCGTGTTCAAACTCGT
AATTACGAGGGAAACGACGGTAAACGTGTTTATGTGACTGAAATTGTAGCAGAGAGTGTTCAATTCCTTGAACCGCGTAA
TTCTAATGGCGGTGGCGGAAATAACTATCAAAGTGGCAATAACAACAATAATTACAATAGCGGTGGAAATAACTTCGGAC
AAGCACCTACAAATAACGGTGGATTCGGACAGGACCAGCAACAATCTCAAAATCAAAATTATCAATCCACTAATAATGAT
CCTTTTGCAAGTGATGGTAAGCCAATCGACATTTCTGATGACGATTTGCCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
68.539 |
100 |
0.685 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.618 |
100 |
0.556 |
| ssb | Glaesserella parasuis strain SC1401 |
35.484 |
100 |
0.371 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
61.321 |
59.551 |
0.365 |