Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   G8O86_RS02035 Genome accession   NZ_CP075877
Coordinates   399043..399522 (-) Length   159 a.a.
NCBI ID   WP_031694734.1    Uniprot ID   -
Organism   Listeria monocytogenes strain 2HF15     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 376591..419066 399043..399522 within 0


Gene organization within MGE regions


Location: 376591..419066
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  G8O86_RS15375 - 376591..377439 (-) 849 WP_023552299.1 N-acetylmuramoyl-L-alanine amidase -
  G8O86_RS01910 - 377436..377720 (-) 285 WP_031694741.1 holin -
  G8O86_RS01915 - 377733..378098 (-) 366 WP_003722523.1 Gp23 family protein -
  G8O86_RS01920 - 378137..379198 (-) 1062 WP_031694740.1 hypothetical protein -
  G8O86_RS01925 - 379191..381482 (-) 2292 WP_031694739.1 phage tail spike protein -
  G8O86_RS01930 - 381488..383731 (-) 2244 WP_014930683.1 distal tail protein Dit -
  G8O86_RS01935 - 383724..387827 (-) 4104 WP_256732757.1 phage tail tape measure protein -
  G8O86_RS01940 gpG 388120..388467 (-) 348 WP_012951331.1 phage tail assembly chaperone G -
  G8O86_RS01945 - 388557..389132 (-) 576 WP_012951330.1 major tail protein -
  G8O86_RS01950 - 389153..389551 (-) 399 WP_014930680.1 hypothetical protein -
  G8O86_RS01955 - 389554..389919 (-) 366 WP_012951328.1 HK97-gp10 family putative phage morphogenesis protein -
  G8O86_RS01960 - 389913..390233 (-) 321 WP_012951327.1 phage head closure protein -
  G8O86_RS01965 - 390203..390541 (-) 339 WP_012951326.1 head-tail connector protein -
  G8O86_RS01970 - 390590..391759 (-) 1170 WP_012951325.1 phage major capsid protein -
  G8O86_RS01975 - 391823..392389 (-) 567 WP_012951324.1 HK97 family phage prohead protease -
  G8O86_RS01980 - 392386..393621 (-) 1236 WP_012951323.1 phage portal protein -
  G8O86_RS01985 - 393624..393824 (-) 201 WP_023552290.1 DUF1056 family protein -
  G8O86_RS01990 - 393831..395582 (-) 1752 WP_012951322.1 terminase large subunit -
  G8O86_RS01995 - 395551..396078 (-) 528 WP_012951321.1 phage terminase small subunit P27 family -
  G8O86_RS15455 - 396177..396536 (-) 360 WP_049961622.1 HNH endonuclease signature motif containing protein -
  G8O86_RS02005 - 396533..396859 (-) 327 WP_031694737.1 hypothetical protein -
  G8O86_RS02010 - 397130..397396 (-) 267 WP_031694736.1 hypothetical protein -
  G8O86_RS02015 - 397479..398021 (-) 543 WP_023552281.1 tyrosine-type recombinase/integrase -
  G8O86_RS02020 - 398018..398536 (-) 519 WP_023552279.1 sigma factor-like helix-turn-helix DNA-binding protein -
  G8O86_RS02025 - 398607..398777 (-) 171 WP_023552276.1 hypothetical protein -
  G8O86_RS02030 - 398783..399022 (-) 240 WP_023552274.1 hypothetical protein -
  G8O86_RS02035 ssbA 399043..399522 (-) 480 WP_031694734.1 single-stranded DNA-binding protein Machinery gene
  G8O86_RS02040 - 399522..400103 (-) 582 WP_023552268.1 DUF3310 domain-containing protein -
  G8O86_RS02045 - 400103..400351 (-) 249 WP_023552266.1 ASCH/PUA domain-containing protein -
  G8O86_RS02050 - 400372..400755 (-) 384 WP_023552263.1 hypothetical protein -
  G8O86_RS15380 - 400752..400865 (-) 114 Protein_412 hypothetical protein -
  G8O86_RS02080 - 401396..401866 (-) 471 WP_003722556.1 pentapeptide repeat-containing protein -
  G8O86_RS02085 - 401863..402306 (-) 444 WP_003722557.1 YopX family protein -
  G8O86_RS02090 - 402303..402500 (-) 198 WP_003722558.1 hypothetical protein -
  G8O86_RS02095 - 402503..403099 (-) 597 WP_003722559.1 DUF1642 domain-containing protein -
  G8O86_RS02100 - 403096..403908 (-) 813 WP_173346365.1 DNA adenine methylase -
  G8O86_RS02105 - 403920..404450 (-) 531 WP_060579690.1 hypothetical protein -
  G8O86_RS02110 - 404447..404734 (-) 288 WP_060579691.1 hypothetical protein -
  G8O86_RS02115 - 404731..405645 (-) 915 WP_052930229.1 hypothetical protein -
  G8O86_RS02120 - 405675..406490 (-) 816 WP_052930230.1 recombinase RecT -
  G8O86_RS02125 - 406490..407449 (-) 960 WP_015987423.1 YqaJ viral recombinase family protein -
  G8O86_RS02130 - 407685..407873 (-) 189 WP_003731809.1 gp45 family putative tail fiber system protein -
  G8O86_RS02135 - 407981..408217 (-) 237 WP_003731810.1 DUF771 domain-containing protein -
  G8O86_RS02140 - 408224..408748 (-) 525 WP_015987420.1 hypothetical protein -
  G8O86_RS02145 - 408870..409643 (-) 774 WP_015987419.1 phage repressor protein/antirepressor Ant -
  G8O86_RS15460 - 409601..409708 (-) 108 Protein_427 hypothetical protein -
  G8O86_RS02150 - 409707..410249 (+) 543 WP_003731223.1 hypothetical protein -
  G8O86_RS02155 - 410305..410580 (-) 276 Protein_429 hypothetical protein -
  G8O86_RS02160 - 410577..410813 (-) 237 WP_015987418.1 hypothetical protein -
  G8O86_RS02165 - 410817..411068 (-) 252 WP_003731220.1 helix-turn-helix domain-containing protein -
  G8O86_RS02170 - 411217..411525 (+) 309 WP_015987417.1 helix-turn-helix domain-containing protein -
  G8O86_RS02175 - 411557..412048 (+) 492 WP_003731218.1 ImmA/IrrE family metallo-endopeptidase -
  G8O86_RS02180 - 412075..412584 (+) 510 WP_003731217.1 lipoprotein -
  G8O86_RS02185 - 412648..413778 (+) 1131 WP_003731216.1 site-specific integrase -
  G8O86_RS02195 - 414054..415490 (-) 1437 WP_003722599.1 polysaccharide monooxygenase -
  G8O86_RS02200 clpP 415647..416243 (+) 597 WP_003722600.1 ATP-dependent Clp endopeptidase proteolytic subunit ClpP -
  G8O86_RS02205 - 416291..417682 (-) 1392 WP_003732491.1 amino acid permease -
  G8O86_RS02210 - 417900..419066 (+) 1167 WP_003722602.1 internalin N-terminal domain-containing protein -

Sequence

Protein


Download         Length: 159 a.a.        Molecular weight: 17524.47 Da        Isoelectric Point: 5.2652

>NTDB_id=570591 G8O86_RS02035 WP_031694734.1 399043..399522(-) (ssbA) [Listeria monocytogenes strain 2HF15]
MMNRVVLVGRLTKDPDLRYTPAGAAVATFTLAVNRPFKNAQGEQEADFINCVVWRKPAENVANFLKKGSMAGVDGRVQTR
NYEDNDGKRVFVTEVVAESVQFLEPKNNQGRASTNDYQNKANYSNNIQTSSYAADASQKGGAFVNDSKPIDIPDDDLPF

Nucleotide


Download         Length: 480 bp        

>NTDB_id=570591 G8O86_RS02035 WP_031694734.1 399043..399522(-) (ssbA) [Listeria monocytogenes strain 2HF15]
ATGATGAATCGTGTAGTGCTTGTAGGTCGATTAACTAAAGACCCTGATTTACGATATACGCCAGCAGGCGCGGCTGTTGC
GACTTTTACATTAGCTGTAAATCGCCCATTTAAAAATGCACAAGGAGAACAAGAAGCCGATTTCATTAATTGTGTTGTTT
GGCGAAAACCAGCAGAAAACGTTGCTAATTTCTTGAAGAAAGGAAGCATGGCGGGCGTTGACGGTCGCGTACAGACTCGA
AATTACGAAGATAACGACGGTAAACGTGTTTTCGTTACAGAAGTAGTAGCTGAATCAGTTCAATTCTTAGAACCTAAAAA
CAACCAAGGAAGAGCTTCAACAAATGATTATCAAAACAAAGCTAATTATTCAAACAACATCCAAACAAGCTCATATGCAG
CGGATGCGAGTCAGAAAGGCGGTGCATTTGTTAATGATAGCAAGCCAATCGATATTCCAGATGATGATTTACCGTTTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

61.798

100

0.692
  ssb Latilactobacillus sakei subsp. sakei 23K

54.335

100

0.591
  ssbB Bacillus subtilis subsp. subtilis str. 168

66.038

66.667

0.44
  ssb Neisseria meningitidis MC58

33.333

100

0.365