Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | KI818_RS00480 | Genome accession | NZ_CP075562 |
| Coordinates | 105572..106042 (+) | Length | 156 a.a. |
| NCBI ID | WP_029549393.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain Sta2021010 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 95632..131675 | 105572..106042 | within | 0 |
Gene organization within MGE regions
Location: 95632..131675
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KI818_RS00410 (KI818_00410) | - | 95632..97008 (-) | 1377 | WP_031767029.1 | recombinase family protein | - |
| KI818_RS00415 (KI818_00415) | - | 97066..98307 (-) | 1242 | WP_220107755.1 | SAP domain-containing protein | - |
| KI818_RS00420 (KI818_00420) | - | 98352..99026 (-) | 675 | WP_031916497.1 | ImmA/IrrE family metallo-endopeptidase | - |
| KI818_RS00425 (KI818_00425) | - | 99043..99375 (-) | 333 | WP_001055142.1 | helix-turn-helix domain-containing protein | - |
| KI818_RS00430 (KI818_00430) | - | 99638..99832 (+) | 195 | WP_031916498.1 | helix-turn-helix transcriptional regulator | - |
| KI818_RS00435 (KI818_00435) | - | 99841..100605 (+) | 765 | WP_220107758.1 | phage antirepressor KilAC domain-containing protein | - |
| KI818_RS00440 (KI818_00440) | tscA | 100606..100830 (+) | 225 | WP_086095206.1 | type II toxin-antitoxin system antitoxin TscA | - |
| KI818_RS00445 | - | 100870..100969 (+) | 100 | Protein_84 | hypothetical protein | - |
| KI818_RS00450 (KI818_00450) | - | 101213..101374 (+) | 162 | WP_000066025.1 | DUF1270 domain-containing protein | - |
| KI818_RS00455 (KI818_00455) | - | 101467..101727 (+) | 261 | WP_220107754.1 | DUF1108 family protein | - |
| KI818_RS00460 (KI818_00460) | - | 101736..101999 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| KI818_RS00465 (KI818_00465) | - | 102008..103951 (+) | 1944 | WP_255777530.1 | AAA family ATPase | - |
| KI818_RS00470 (KI818_00470) | - | 103953..104873 (+) | 921 | WP_000138475.1 | recombinase RecT | - |
| KI818_RS00475 (KI818_00475) | - | 104954..105571 (+) | 618 | WP_072528355.1 | MBL fold metallo-hydrolase | - |
| KI818_RS00480 (KI818_00480) | ssbA | 105572..106042 (+) | 471 | WP_029549393.1 | single-stranded DNA-binding protein | Machinery gene |
| KI818_RS00485 (KI818_00485) | - | 106072..106956 (+) | 885 | WP_031833239.1 | DnaD domain protein | - |
| KI818_RS00490 (KI818_00490) | - | 106963..107181 (+) | 219 | WP_000338528.1 | hypothetical protein | - |
| KI818_RS00495 (KI818_00495) | - | 107190..107594 (+) | 405 | WP_138388259.1 | RusA family crossover junction endodeoxyribonuclease | - |
| KI818_RS00500 (KI818_00500) | - | 107607..107975 (+) | 369 | WP_001140280.1 | SA1788 family PVL leukocidin-associated protein | - |
| KI818_RS00505 (KI818_00505) | - | 107979..108221 (+) | 243 | WP_072328473.1 | phi PVL orf 51-like protein | - |
| KI818_RS00510 (KI818_00510) | - | 108236..108472 (+) | 237 | WP_001065101.1 | DUF1024 family protein | - |
| KI818_RS00515 (KI818_00515) | - | 108462..108704 (+) | 243 | WP_000700108.1 | hypothetical protein | - |
| KI818_RS00520 (KI818_00520) | - | 108697..109230 (+) | 534 | WP_234100645.1 | dUTP diphosphatase | - |
| KI818_RS00525 (KI818_00525) | - | 109267..109473 (+) | 207 | WP_000195770.1 | DUF1381 domain-containing protein | - |
| KI818_RS00530 (KI818_00530) | - | 109470..109664 (+) | 195 | WP_000141183.1 | hypothetical protein | - |
| KI818_RS00535 (KI818_00535) | - | 109661..109864 (+) | 204 | WP_156974721.1 | hypothetical protein | - |
| KI818_RS00540 (KI818_00540) | rinB | 109857..110030 (+) | 174 | WP_158171474.1 | transcriptional activator RinB | - |
| KI818_RS00545 (KI818_00545) | - | 110031..110177 (+) | 147 | WP_000990005.1 | hypothetical protein | - |
| KI818_RS00550 (KI818_00550) | - | 110192..110611 (+) | 420 | WP_000058632.1 | transcriptional regulator | - |
| KI818_RS00555 (KI818_00555) | - | 110800..111240 (+) | 441 | WP_001566315.1 | terminase small subunit | - |
| KI818_RS00560 (KI818_00560) | - | 111227..112501 (+) | 1275 | WP_234494765.1 | PBSX family phage terminase large subunit | - |
| KI818_RS00565 (KI818_00565) | - | 112513..113970 (+) | 1458 | WP_031886348.1 | phage portal protein | - |
| KI818_RS00570 (KI818_00570) | - | 113954..114919 (+) | 966 | WP_031886347.1 | minor capsid protein | - |
| KI818_RS00575 | - | 115004..115135 (+) | 132 | WP_255777531.1 | hypothetical protein | - |
| KI818_RS14135 | - | 115163..115253 (+) | 91 | Protein_111 | hypothetical protein | - |
| KI818_RS00580 (KI818_00575) | - | 115247..115882 (+) | 636 | WP_031886346.1 | DUF4355 domain-containing protein | - |
| KI818_RS00585 (KI818_00580) | - | 115900..116805 (+) | 906 | WP_031886345.1 | hypothetical protein | - |
| KI818_RS00590 (KI818_00585) | - | 116820..117059 (+) | 240 | WP_031886344.1 | hypothetical protein | - |
| KI818_RS00595 (KI818_00590) | - | 117069..117398 (+) | 330 | WP_031886343.1 | phage head-tail connector protein | - |
| KI818_RS00600 (KI818_00595) | - | 117422..117697 (+) | 276 | WP_150530786.1 | hypothetical protein | - |
| KI818_RS00605 (KI818_00600) | - | 117697..118038 (+) | 342 | WP_031886341.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| KI818_RS00610 (KI818_00605) | - | 118049..118435 (+) | 387 | WP_031886340.1 | hypothetical protein | - |
| KI818_RS00615 (KI818_00610) | - | 118453..119013 (+) | 561 | WP_049949214.1 | phage major tail protein, TP901-1 family | - |
| KI818_RS00620 (KI818_00615) | - | 119087..119452 (+) | 366 | WP_031886338.1 | tail assembly chaperone | - |
| KI818_RS00625 (KI818_00620) | - | 119497..119874 (+) | 378 | WP_031886337.1 | hypothetical protein | - |
| KI818_RS00630 (KI818_00625) | - | 119867..123526 (+) | 3660 | WP_049949213.1 | hypothetical protein | - |
| KI818_RS00635 (KI818_00630) | - | 123549..124502 (+) | 954 | WP_031886336.1 | phage tail domain-containing protein | - |
| KI818_RS00640 (KI818_00635) | - | 124519..125634 (+) | 1116 | WP_031886335.1 | hypothetical protein | - |
| KI818_RS00645 (KI818_00640) | - | 125650..127836 (+) | 2187 | WP_031886334.1 | phage tail protein | - |
| KI818_RS00650 (KI818_00645) | - | 127823..127972 (+) | 150 | WP_162783876.1 | hypothetical protein | - |
| KI818_RS00655 (KI818_00650) | - | 128021..128320 (+) | 300 | WP_031886333.1 | DUF2951 domain-containing protein | - |
| KI818_RS00660 (KI818_00655) | - | 128557..128664 (+) | 108 | WP_000253687.1 | putative holin-like toxin | - |
| KI818_RS00665 (KI818_00660) | - | 128704..128811 (-) | 108 | Protein_129 | hypothetical protein | - |
| KI818_RS00670 (KI818_00665) | - | 128862..129299 (+) | 438 | WP_031886332.1 | phage holin | - |
| KI818_RS00675 (KI818_00670) | - | 129280..130725 (+) | 1446 | WP_234494763.1 | SH3 domain-containing protein | - |
| KI818_RS00680 (KI818_00675) | - | 131254..131460 (+) | 207 | WP_000125170.1 | hypothetical protein | - |
| KI818_RS00685 (KI818_00680) | - | 131475..131675 (+) | 201 | WP_000498229.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17654.38 Da Isoelectric Point: 4.6228
>NTDB_id=569585 KI818_RS00480 WP_029549393.1 105572..106042(+) (ssbA) [Staphylococcus aureus strain Sta2021010]
MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFVNCVVFRRQADNVNNYLSKGSLAGVDGRLQSR
NYENQEGRRVFVTEVVCDSVQFLEPKNTNDSQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANDPIEIDDDDLPF
MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFVNCVVFRRQADNVNNYLSKGSLAGVDGRLQSR
NYENQEGRRVFVTEVVCDSVQFLEPKNTNDSQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANDPIEIDDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=569585 KI818_RS00480 WP_029549393.1 105572..106042(+) (ssbA) [Staphylococcus aureus strain Sta2021010]
ATGCTAAATAGAGTTGTATTAGTAGGTCGTTTAACGAAAGATCCGGAATACAGAACCACTCCTTCAGGTGTGAGTGTAGC
GACATTCACTCTTGCAGTAAATCGTACGTTCACGAATGCTCAAGGGGAGCGCGAAGCAGATTTTGTTAACTGTGTTGTTT
TTAGAAGACAAGCAGATAATGTAAATAACTATTTATCTAAAGGTAGTTTAGCTGGTGTAGATGGTCGCTTACAATCCCGT
AATTATGAAAATCAAGAAGGTCGTCGTGTGTTTGTTACTGAAGTTGTGTGTGATAGCGTTCAATTTTTAGAACCAAAGAA
CACAAATGACTCTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTCGCAAATGCGAATGATCCTATTGAAATAGATGACGATGATTTACCATTCTAA
ATGCTAAATAGAGTTGTATTAGTAGGTCGTTTAACGAAAGATCCGGAATACAGAACCACTCCTTCAGGTGTGAGTGTAGC
GACATTCACTCTTGCAGTAAATCGTACGTTCACGAATGCTCAAGGGGAGCGCGAAGCAGATTTTGTTAACTGTGTTGTTT
TTAGAAGACAAGCAGATAATGTAAATAACTATTTATCTAAAGGTAGTTTAGCTGGTGTAGATGGTCGCTTACAATCCCGT
AATTATGAAAATCAAGAAGGTCGTCGTGTGTTTGTTACTGAAGTTGTGTGTGATAGCGTTCAATTTTTAGAACCAAAGAA
CACAAATGACTCTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTCGCAAATGCGAATGATCCTATTGAAATAGATGACGATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
61.017 |
100 |
0.692 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
52.353 |
100 |
0.571 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |