Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   HPOK310_RS08065 Genome accession   NC_020509
Coordinates   1325253..1325378 (-) Length   41 a.a.
NCBI ID   WP_075668089.1    Uniprot ID   -
Organism   Helicobacter pylori OK310     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1320253..1330378
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HPOK310_RS06430 (HPOK310_1235) - 1320943..1322355 (-) 1413 WP_015429413.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  HPOK310_RS06435 (HPOK310_1236) comB10 1322422..1323558 (-) 1137 WP_015429414.1 DNA type IV secretion system protein ComB10 Machinery gene
  HPOK310_RS06440 (HPOK310_1237) comB9 1323551..1324513 (-) 963 WP_015429415.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HPOK310_RS06445 (HPOK310_1238) comB8 1324513..1325256 (-) 744 WP_015429416.1 type IV secretion system protein Machinery gene
  HPOK310_RS08065 comB7 1325253..1325378 (-) 126 WP_075668089.1 comB7 lipoprotein Machinery gene
  HPOK310_RS06450 (HPOK310_1239) comB6 1325394..1326449 (-) 1056 WP_015429417.1 P-type conjugative transfer protein TrbL Machinery gene
  HPOK310_RS06455 (HPOK310_1240) - 1326457..1327461 (-) 1005 WP_015429418.1 PDZ domain-containing protein -
  HPOK310_RS06460 (HPOK310_1241) - 1327461..1327754 (-) 294 WP_000347916.1 YbaB/EbfC family nucleoid-associated protein -
  HPOK310_RS06465 (HPOK310_1242) panD 1327765..1328115 (-) 351 WP_000142213.1 aspartate 1-decarboxylase -
  HPOK310_RS06470 (HPOK310_1243) - 1328105..1330327 (-) 2223 WP_015429419.1 AAA family ATPase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4738.72 Da        Isoelectric Point: 9.3278

>NTDB_id=56657 HPOK310_RS08065 WP_075668089.1 1325253..1325378(-) (comB7) [Helicobacter pylori OK310]
MRIFSVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=56657 HPOK310_RS08065 WP_075668089.1 1325253..1325378(-) (comB7) [Helicobacter pylori OK310]
ATGAGAATTTTTTCTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

85.366

100

0.854

Multiple sequence alignment