Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   BSU6051_RS12825 Genome accession   NC_020507
Coordinates   2556495..2556878 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. subtilis 6051-HGW     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2551495..2561878
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSU6051_RS12785 (BSU6051_24600) sinI 2552429..2552602 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  BSU6051_RS12790 (BSU6051_24610) sinR 2552636..2552971 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  BSU6051_RS12795 (BSU6051_24620) tasA 2553064..2553849 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  BSU6051_RS12800 (BSU6051_24630) sipW 2553913..2554485 (-) 573 WP_003246088.1 signal peptidase I SipW -
  BSU6051_RS12805 (BSU6051_24640) tapA 2554469..2555230 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  BSU6051_RS12810 (BSU6051_24650) yqzG 2555502..2555828 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  BSU6051_RS12815 (BSU6051_24660) spoIITA 2555870..2556049 (-) 180 WP_003230176.1 YqzE family protein -
  BSU6051_RS12820 (BSU6051_24670) comGG 2556120..2556494 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  BSU6051_RS12825 (BSU6051_24680) comGF 2556495..2556878 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  BSU6051_RS12830 (BSU6051_24690) comGE 2556904..2557251 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  BSU6051_RS12835 (BSU6051_24700) comGD 2557235..2557666 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  BSU6051_RS12840 (BSU6051_24710) comGC 2557656..2557952 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  BSU6051_RS12845 (BSU6051_24720) comGB 2557966..2559003 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  BSU6051_RS12850 (BSU6051_24730) comGA 2558990..2560060 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  BSU6051_RS12855 (BSU6051_24740) corA 2560472..2561425 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=56575 BSU6051_RS12825 WP_003230168.1 2556495..2556878(-) (comGF) [Bacillus subtilis subsp. subtilis 6051-HGW]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=56575 BSU6051_RS12825 WP_003230168.1 2556495..2556878(-) (comGF) [Bacillus subtilis subsp. subtilis 6051-HGW]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment