Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   BSU6051_RS12785 Genome accession   NC_020507
Coordinates   2552429..2552602 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis subsp. subtilis 6051-HGW     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2547429..2557602
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSU6051_RS12770 (BSU6051_24570) gcvT 2548228..2549316 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  BSU6051_RS12775 (BSU6051_24580) hepAA 2549758..2551431 (+) 1674 WP_004398544.1 SNF2-related protein -
  BSU6051_RS12780 (BSU6051_24590) yqhG 2551452..2552246 (+) 795 WP_003230200.1 YqhG family protein -
  BSU6051_RS12785 (BSU6051_24600) sinI 2552429..2552602 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  BSU6051_RS12790 (BSU6051_24610) sinR 2552636..2552971 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  BSU6051_RS12795 (BSU6051_24620) tasA 2553064..2553849 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  BSU6051_RS12800 (BSU6051_24630) sipW 2553913..2554485 (-) 573 WP_003246088.1 signal peptidase I SipW -
  BSU6051_RS12805 (BSU6051_24640) tapA 2554469..2555230 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  BSU6051_RS12810 (BSU6051_24650) yqzG 2555502..2555828 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  BSU6051_RS12815 (BSU6051_24660) spoIITA 2555870..2556049 (-) 180 WP_003230176.1 YqzE family protein -
  BSU6051_RS12820 (BSU6051_24670) comGG 2556120..2556494 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  BSU6051_RS12825 (BSU6051_24680) comGF 2556495..2556878 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  BSU6051_RS12830 (BSU6051_24690) comGE 2556904..2557251 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=56572 BSU6051_RS12785 WP_003230187.1 2552429..2552602(+) (sinI) [Bacillus subtilis subsp. subtilis 6051-HGW]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=56572 BSU6051_RS12785 WP_003230187.1 2552429..2552602(+) (sinI) [Bacillus subtilis subsp. subtilis 6051-HGW]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment