Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   KCV17_RS16480 Genome accession   NZ_CP073248
Coordinates   3585620..3586117 (-) Length   165 a.a.
NCBI ID   WP_049212214.1    Uniprot ID   A0AAJ4RET5
Organism   Proteus mirabilis strain N292     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 3582331..3622511 3585620..3586117 within 0


Gene organization within MGE regions


Location: 3582331..3622511
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KCV17_RS16435 - 3582331..3583326 (-) 996 WP_049211075.1 tyrosine-type recombinase/integrase -
  KCV17_RS16440 - 3583283..3583528 (-) 246 WP_049211074.1 excisionase -
  KCV17_RS16445 - 3583525..3583863 (-) 339 WP_004247455.1 phage protein NinX family protein -
  KCV17_RS16450 - 3583856..3584032 (-) 177 WP_012367596.1 hypothetical protein -
  KCV17_RS16455 - 3584190..3584435 (-) 246 WP_049211072.1 hypothetical protein -
  KCV17_RS16460 - 3584428..3584697 (-) 270 WP_049211071.1 hypothetical protein -
  KCV17_RS16465 - 3584697..3584870 (-) 174 WP_232467315.1 hypothetical protein -
  KCV17_RS16470 - 3584906..3585232 (-) 327 WP_036932464.1 hypothetical protein -
  KCV17_RS16475 - 3585266..3585604 (-) 339 WP_049212213.1 hypothetical protein -
  KCV17_RS16480 ssb 3585620..3586117 (-) 498 WP_049212214.1 single-stranded DNA-binding protein Machinery gene
  KCV17_RS16485 - 3586176..3587003 (-) 828 WP_163773628.1 DUF2303 family protein -
  KCV17_RS16490 - 3587069..3587443 (-) 375 WP_012367779.1 hypothetical protein -
  KCV17_RS16495 - 3588015..3588704 (-) 690 WP_049211705.1 helix-turn-helix transcriptional regulator -
  KCV17_RS16500 - 3588802..3589017 (+) 216 WP_049210565.1 helix-turn-helix transcriptional regulator -
  KCV17_RS16505 - 3589074..3589736 (+) 663 WP_049219117.1 hypothetical protein -
  KCV17_RS16510 - 3589752..3590210 (+) 459 WP_049219115.1 YmfL family putative regulatory protein -
  KCV17_RS16515 - 3590465..3590644 (+) 180 WP_004251656.1 DUF4222 domain-containing protein -
  KCV17_RS16520 - 3590657..3591718 (+) 1062 WP_164527095.1 conserved phage C-terminal domain-containing protein -
  KCV17_RS16525 - 3591718..3592356 (+) 639 WP_164527192.1 phage N-6-adenine-methyltransferase -
  KCV17_RS16530 - 3592353..3592748 (+) 396 WP_064506369.1 hypothetical protein -
  KCV17_RS16535 - 3592821..3593204 (+) 384 WP_036904907.1 RusA family crossover junction endodeoxyribonuclease -
  KCV17_RS16540 - 3593223..3594026 (+) 804 WP_071425693.1 KilA-N domain-containing protein -
  KCV17_RS16545 - 3594023..3595048 (+) 1026 WP_164527093.1 DUF968 domain-containing protein -
  KCV17_RS16550 - 3595076..3595747 (+) 672 WP_070486601.1 bacteriophage antitermination protein Q -
  KCV17_RS16555 - 3595915..3596109 (+) 195 WP_049210579.1 hypothetical protein -
  KCV17_RS16560 - 3596183..3597205 (+) 1023 WP_164527092.1 site-specific DNA-methyltransferase -
  KCV17_RS16565 - 3597386..3597697 (+) 312 WP_049217869.1 hypothetical protein -
  KCV17_RS16570 - 3597651..3597908 (-) 258 WP_049217868.1 hypothetical protein -
  KCV17_RS16575 - 3598047..3598316 (+) 270 WP_004250558.1 hypothetical protein -
  KCV17_RS16580 - 3598316..3598786 (+) 471 WP_049257301.1 lysozyme -
  KCV17_RS16585 - 3598929..3599390 (+) 462 WP_135017249.1 lysis protein -
  KCV17_RS16590 - 3599663..3599818 (-) 156 WP_155115349.1 hypothetical protein -
  KCV17_RS16595 - 3599902..3600240 (+) 339 WP_001967215.1 HNH endonuclease -
  KCV17_RS16600 - 3600243..3600455 (+) 213 WP_036905782.1 hypothetical protein -
  KCV17_RS16605 - 3600579..3601046 (+) 468 WP_036905779.1 phage terminase small subunit P27 family -
  KCV17_RS16610 - 3601000..3602733 (+) 1734 WP_012367783.1 terminase TerL endonuclease subunit -
  KCV17_RS16615 - 3602733..3604001 (+) 1269 WP_164527091.1 phage portal protein -
  KCV17_RS16620 - 3604019..3604687 (+) 669 WP_004251596.1 HK97 family phage prohead protease -
  KCV17_RS16625 - 3604691..3605857 (+) 1167 WP_004251594.1 phage major capsid protein -
  KCV17_RS16630 - 3605896..3606195 (+) 300 WP_164527090.1 head-tail connector protein -
  KCV17_RS16635 - 3606195..3606524 (+) 330 WP_004251588.1 phage head closure protein -
  KCV17_RS16640 - 3606514..3606987 (+) 474 WP_071425492.1 HK97-gp10 family putative phage morphogenesis protein -
  KCV17_RS16645 - 3606993..3607334 (+) 342 WP_004251583.1 DUF3168 domain-containing protein -
  KCV17_RS16650 - 3607344..3608009 (+) 666 WP_004251580.1 hypothetical protein -
  KCV17_RS16655 - 3608074..3608490 (+) 417 WP_163748728.1 hypothetical protein -
  KCV17_RS16660 - 3608535..3608765 (+) 231 WP_004251574.1 DUF4035 domain-containing protein -
  KCV17_RS16665 - 3608806..3612057 (+) 3252 WP_164527089.1 phage tail tape measure protein -
  KCV17_RS16670 - 3612058..3612654 (+) 597 WP_164527088.1 hypothetical protein -
  KCV17_RS16675 - 3612654..3613235 (+) 582 WP_049206482.1 hypothetical protein -
  KCV17_RS16680 - 3613253..3613801 (+) 549 WP_049206484.1 Ail/Lom family outer membrane beta-barrel protein -
  KCV17_RS16685 - 3613870..3614268 (+) 399 WP_099074617.1 hypothetical protein -
  KCV17_RS16690 - 3614268..3617954 (+) 3687 WP_164527087.1 DUF1983 domain-containing protein -
  KCV17_RS16695 - 3617960..3618316 (+) 357 WP_223307229.1 hypothetical protein -
  KCV17_RS16700 - 3618318..3618932 (+) 615 WP_004247523.1 hypothetical protein -
  KCV17_RS16705 - 3618982..3619242 (+) 261 WP_004245934.1 hypothetical protein -
  KCV17_RS16710 - 3619426..3619851 (+) 426 WP_241260837.1 hypothetical protein -
  KCV17_RS16715 - 3619944..3620249 (-) 306 WP_049211399.1 helix-turn-helix transcriptional regulator -
  KCV17_RS16720 - 3620640..3620900 (-) 261 WP_230506988.1 hypothetical protein -
  KCV17_RS16725 - 3620905..3621135 (-) 231 WP_046335367.1 DNA polymerase III subunit theta -
  KCV17_RS16730 - 3621413..3621751 (+) 339 WP_036918397.1 Grx4 family monothiol glutaredoxin -
  KCV17_RS16735 rnt 3621873..3622511 (-) 639 WP_004243132.1 ribonuclease T -

Sequence

Protein


Download         Length: 165 a.a.        Molecular weight: 17966.31 Da        Isoelectric Point: 7.1636

>NTDB_id=558558 KCV17_RS16480 WP_049212214.1 3585620..3586117(-) (ssb) [Proteus mirabilis strain N292]
MANGSVNKVILIGNLGRDPEIRYLPSGGAVANLAVATSEKWRDKQTGENREKTEWHRVVLFGKLADIASGYLCKGSQVYI
EGQLQTREWDDNGVKRYTTEIVVKIGGSMQMLGGASKSAGSQPAQQNPPPAQPQAQSSQPPMDFDDDIPFAPIGLPYPRH
AIYVI

Nucleotide


Download         Length: 498 bp        

>NTDB_id=558558 KCV17_RS16480 WP_049212214.1 3585620..3586117(-) (ssb) [Proteus mirabilis strain N292]
ATGGCTAACGGATCAGTAAACAAAGTAATTCTTATCGGCAATTTAGGGCGTGATCCTGAAATTCGTTATCTTCCTTCTGG
TGGTGCTGTTGCCAATTTAGCTGTGGCCACATCAGAAAAATGGCGTGACAAACAAACAGGTGAAAATCGCGAAAAAACAG
AATGGCATCGTGTCGTTCTGTTTGGAAAACTCGCTGATATCGCCAGTGGCTATTTATGTAAAGGCTCGCAAGTTTATATC
GAGGGCCAACTACAAACGCGCGAGTGGGATGATAACGGCGTTAAACGCTATACAACAGAAATTGTTGTAAAGATTGGCGG
TTCAATGCAAATGCTAGGTGGTGCTAGTAAATCAGCAGGTTCACAACCGGCACAGCAAAACCCGCCACCGGCTCAACCTC
AAGCACAGAGTAGTCAACCACCAATGGATTTCGATGACGACATCCCCTTTGCCCCTATCGGACTCCCCTACCCACGCCAC
GCTATTTATGTGATTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(6-111)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

57.627

100

0.618
  ssb Glaesserella parasuis strain SC1401

50

100

0.545
  ssb Neisseria meningitidis MC58

42.938

100

0.461
  ssb Neisseria gonorrhoeae MS11

42.938

100

0.461