Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | KCV17_RS03055 | Genome accession | NZ_CP073248 |
| Coordinates | 628919..629452 (+) | Length | 177 a.a. |
| NCBI ID | WP_164527029.1 | Uniprot ID | - |
| Organism | Proteus mirabilis strain N292 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 589782..632683 | 628919..629452 | within | 0 |
Gene organization within MGE regions
Location: 589782..632683
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KCV17_RS02745 | - | 589782..591146 (-) | 1365 | WP_237075684.1 | hypothetical protein | - |
| KCV17_RS02750 | - | 591152..591808 (-) | 657 | WP_049213669.1 | DUF2612 domain-containing protein | - |
| KCV17_RS02755 | - | 591805..592992 (-) | 1188 | WP_109828977.1 | baseplate J/gp47 family protein | - |
| KCV17_RS02760 | - | 592985..593329 (-) | 345 | WP_004250600.1 | hypothetical protein | - |
| KCV17_RS02765 | - | 593326..594018 (-) | 693 | WP_036895343.1 | Gp138 family membrane-puncturing spike protein | - |
| KCV17_RS02770 | - | 594021..594836 (-) | 816 | WP_164527049.1 | hypothetical protein | - |
| KCV17_RS02775 | - | 594802..595119 (-) | 318 | WP_020945489.1 | hypothetical protein | - |
| KCV17_RS02780 | - | 595119..595646 (-) | 528 | WP_004250592.1 | phage baseplate protein | - |
| KCV17_RS02785 | - | 595643..597904 (-) | 2262 | WP_164526978.1 | hypothetical protein | - |
| KCV17_RS02790 | - | 597988..598446 (-) | 459 | WP_004250588.1 | hypothetical protein | - |
| KCV17_RS02795 | - | 598487..598939 (-) | 453 | WP_004250586.1 | hypothetical protein | - |
| KCV17_RS02800 | - | 598950..600437 (-) | 1488 | WP_164527048.1 | DUF3383 domain-containing protein | - |
| KCV17_RS02805 | - | 600446..600961 (-) | 516 | WP_004250583.1 | hypothetical protein | - |
| KCV17_RS02810 | - | 600948..601319 (-) | 372 | WP_004250582.1 | hypothetical protein | - |
| KCV17_RS02815 | - | 601319..601777 (-) | 459 | WP_004250581.1 | hypothetical protein | - |
| KCV17_RS02820 | - | 601777..602208 (-) | 432 | WP_004250580.1 | DUF4054 domain-containing protein | - |
| KCV17_RS02825 | - | 602211..602552 (-) | 342 | WP_004250579.1 | hypothetical protein | - |
| KCV17_RS02830 | - | 602622..603689 (-) | 1068 | WP_004250578.1 | major capsid family protein | - |
| KCV17_RS02835 | - | 603689..604186 (-) | 498 | WP_036908136.1 | hypothetical protein | - |
| KCV17_RS02840 | - | 604186..605445 (-) | 1260 | WP_164527047.1 | DUF2213 domain-containing protein | - |
| KCV17_RS02845 | - | 605442..606155 (-) | 714 | WP_164527190.1 | phage minor head protein | - |
| KCV17_RS02850 | - | 606193..607695 (-) | 1503 | WP_164527046.1 | DUF1073 domain-containing protein | - |
| KCV17_RS02855 | - | 607699..608928 (-) | 1230 | WP_164527045.1 | PBSX family phage terminase large subunit | - |
| KCV17_RS02860 | - | 608909..609331 (-) | 423 | WP_164527044.1 | DNA-packaging protein | - |
| KCV17_RS18300 | - | 609348..609473 (-) | 126 | WP_265796551.1 | hypothetical protein | - |
| KCV17_RS02870 | - | 609539..609727 (-) | 189 | WP_071233628.1 | hypothetical protein | - |
| KCV17_RS02875 | - | 609827..610516 (-) | 690 | WP_072063061.1 | Rha family transcriptional regulator | - |
| KCV17_RS02880 | - | 611028..611396 (-) | 369 | WP_064497290.1 | hypothetical protein | - |
| KCV17_RS02885 | - | 611393..611842 (-) | 450 | WP_164527043.1 | lysis protein | - |
| KCV17_RS02890 | - | 611844..612176 (-) | 333 | WP_164527042.1 | M15 family metallopeptidase | - |
| KCV17_RS02895 | - | 612173..612508 (-) | 336 | WP_115370795.1 | phage holin, lambda family | - |
| KCV17_RS02900 | - | 613040..613795 (-) | 756 | WP_164527041.1 | antitermination protein | - |
| KCV17_RS02905 | - | 613997..614362 (-) | 366 | WP_161769586.1 | RusA family crossover junction endodeoxyribonuclease | - |
| KCV17_RS02910 | - | 614359..614649 (-) | 291 | WP_164527040.1 | DUF1364 domain-containing protein | - |
| KCV17_RS02915 | - | 614642..614794 (-) | 153 | WP_159262704.1 | hypothetical protein | - |
| KCV17_RS02920 | - | 614887..615327 (-) | 441 | WP_164527039.1 | DUF1828 domain-containing protein | - |
| KCV17_RS02925 | - | 615324..615548 (-) | 225 | WP_164527038.1 | DUF3310 domain-containing protein | - |
| KCV17_RS02930 | - | 615712..615894 (-) | 183 | WP_164527037.1 | hypothetical protein | - |
| KCV17_RS02935 | - | 615910..616356 (-) | 447 | WP_164527036.1 | DUF1367 family protein | - |
| KCV17_RS02940 | - | 616381..616659 (-) | 279 | WP_164527035.1 | hypothetical protein | - |
| KCV17_RS02945 | - | 616656..616880 (-) | 225 | WP_164527034.1 | DUF551 domain-containing protein | - |
| KCV17_RS02950 | - | 616894..617229 (-) | 336 | WP_196565552.1 | hypothetical protein | - |
| KCV17_RS02955 | - | 617249..618205 (-) | 957 | WP_074561841.1 | primase-helicase zinc-binding domain-containing protein | - |
| KCV17_RS02960 | - | 618168..619760 (-) | 1593 | WP_236546529.1 | DEAD/DEAH box helicase | - |
| KCV17_RS02965 | - | 619808..620242 (-) | 435 | WP_226693053.1 | helix-turn-helix domain-containing protein | - |
| KCV17_RS02970 | - | 620500..620826 (-) | 327 | WP_026164645.1 | hypothetical protein | - |
| KCV17_RS02975 | - | 620947..621294 (-) | 348 | WP_074561843.1 | hypothetical protein | - |
| KCV17_RS02980 | - | 621401..621610 (-) | 210 | WP_036943298.1 | helix-turn-helix transcriptional regulator | - |
| KCV17_RS02985 | - | 621718..622362 (+) | 645 | WP_063108495.1 | LexA family transcriptional regulator | - |
| KCV17_RS02990 | - | 622371..622712 (+) | 342 | WP_074561844.1 | DUF3024 domain-containing protein | - |
| KCV17_RS02995 | - | 622823..623521 (+) | 699 | WP_159262675.1 | hypothetical protein | - |
| KCV17_RS03000 | - | 623518..624102 (+) | 585 | WP_074561846.1 | PIN domain-containing protein | - |
| KCV17_RS03005 | - | 624456..624770 (+) | 315 | WP_064971331.1 | hypothetical protein | - |
| KCV17_RS03010 | - | 624843..625079 (+) | 237 | WP_049220845.1 | hypothetical protein | - |
| KCV17_RS03015 | - | 625051..625332 (-) | 282 | WP_049220847.1 | hypothetical protein | - |
| KCV17_RS03020 | - | 625502..626122 (+) | 621 | WP_071233968.1 | Nmad5 family putative nucleotide modification protein | - |
| KCV17_RS03025 | - | 626455..626691 (+) | 237 | WP_159290197.1 | hypothetical protein | - |
| KCV17_RS03030 | - | 626783..627082 (+) | 300 | WP_164527032.1 | hypothetical protein | - |
| KCV17_RS03035 | - | 627303..627578 (+) | 276 | WP_058336156.1 | hypothetical protein | - |
| KCV17_RS03040 | - | 627575..627727 (+) | 153 | WP_164527031.1 | hypothetical protein | - |
| KCV17_RS03045 | - | 627724..628044 (+) | 321 | WP_074924238.1 | hypothetical protein | - |
| KCV17_RS03050 | - | 628046..628918 (+) | 873 | WP_164527030.1 | ATP-binding protein | - |
| KCV17_RS03055 | ssb | 628919..629452 (+) | 534 | WP_164527029.1 | single-stranded DNA-binding protein | Machinery gene |
| KCV17_RS03060 | - | 629493..629657 (+) | 165 | WP_161772802.1 | hook protein | - |
| KCV17_RS03065 | - | 629692..630147 (+) | 456 | WP_161772801.1 | ASCH domain-containing protein | - |
| KCV17_RS03070 | - | 630217..630774 (+) | 558 | WP_164527028.1 | hypothetical protein | - |
| KCV17_RS03075 | - | 630980..631153 (+) | 174 | WP_237075687.1 | hypothetical protein | - |
| KCV17_RS03080 | - | 631163..631483 (+) | 321 | WP_164527027.1 | phage protein NinX family protein | - |
| KCV17_RS03085 | - | 631480..631725 (+) | 246 | WP_012367595.1 | excisionase | - |
| KCV17_RS03090 | - | 631682..632683 (+) | 1002 | WP_026090525.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 177 a.a. Molecular weight: 19524.68 Da Isoelectric Point: 6.4797
>NTDB_id=558541 KCV17_RS03055 WP_164527029.1 628919..629452(+) (ssb) [Proteus mirabilis strain N292]
MAERGVNKAVIIGNLGDDPTVRYSPNGTAFANFSVATSEIWTDKNTGEKRERTDWHNISIQGKLAEIAGQYLKKGSQVYI
EGKMRTRKYQGNDGQDKYITEVIVDMKGTMQMLGGRGGQDNAPSQGQGGWGQPQQPQAQKQASSNQTPQSEPPQDWDDDI
PFAPIGLPYPRHAIYVI
MAERGVNKAVIIGNLGDDPTVRYSPNGTAFANFSVATSEIWTDKNTGEKRERTDWHNISIQGKLAEIAGQYLKKGSQVYI
EGKMRTRKYQGNDGQDKYITEVIVDMKGTMQMLGGRGGQDNAPSQGQGGWGQPQQPQAQKQASSNQTPQSEPPQDWDDDI
PFAPIGLPYPRHAIYVI
Nucleotide
Download Length: 534 bp
>NTDB_id=558541 KCV17_RS03055 WP_164527029.1 628919..629452(+) (ssb) [Proteus mirabilis strain N292]
ATGGCTGAGAGAGGCGTAAATAAAGCGGTCATCATTGGTAACTTAGGCGATGATCCGACAGTTAGATATTCACCTAACGG
AACAGCATTTGCTAATTTCTCAGTCGCTACAAGCGAAATATGGACGGATAAAAACACTGGAGAAAAACGAGAGCGTACAG
ATTGGCATAACATTTCTATACAAGGGAAATTAGCAGAAATAGCAGGTCAATACTTGAAAAAAGGAAGTCAGGTGTACATT
GAAGGGAAAATGCGCACCCGTAAGTATCAAGGTAATGACGGTCAAGATAAGTACATTACTGAGGTTATCGTGGATATGAA
GGGAACAATGCAGATGTTAGGTGGCCGTGGTGGTCAAGATAATGCACCTTCACAAGGCCAAGGCGGTTGGGGTCAACCTC
AGCAACCACAAGCACAAAAACAAGCATCGAGTAATCAAACACCACAAAGTGAACCACCTCAAGATTGGGATGACGATATT
CCCTTTGCCCCTATCGGACTTCCCTACCCACGCCACGCTATTTATGTGATTTAA
ATGGCTGAGAGAGGCGTAAATAAAGCGGTCATCATTGGTAACTTAGGCGATGATCCGACAGTTAGATATTCACCTAACGG
AACAGCATTTGCTAATTTCTCAGTCGCTACAAGCGAAATATGGACGGATAAAAACACTGGAGAAAAACGAGAGCGTACAG
ATTGGCATAACATTTCTATACAAGGGAAATTAGCAGAAATAGCAGGTCAATACTTGAAAAAAGGAAGTCAGGTGTACATT
GAAGGGAAAATGCGCACCCGTAAGTATCAAGGTAATGACGGTCAAGATAAGTACATTACTGAGGTTATCGTGGATATGAA
GGGAACAATGCAGATGTTAGGTGGCCGTGGTGGTCAAGATAATGCACCTTCACAAGGCCAAGGCGGTTGGGGTCAACCTC
AGCAACCACAAGCACAAAAACAAGCATCGAGTAATCAAACACCACAAAGTGAACCACCTCAAGATTGGGATGACGATATT
CCCTTTGCCCCTATCGGACTTCCCTACCCACGCCACGCTATTTATGTGATTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
57.062 |
100 |
0.571 |
| ssb | Glaesserella parasuis strain SC1401 |
48.387 |
100 |
0.508 |
| ssb | Neisseria gonorrhoeae MS11 |
47.727 |
99.435 |
0.475 |
| ssb | Neisseria meningitidis MC58 |
45.763 |
100 |
0.458 |