Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | KBP48_RS03060 | Genome accession | NZ_CP072932 |
| Coordinates | 710890..711336 (-) | Length | 148 a.a. |
| NCBI ID | WP_038210386.1 | Uniprot ID | A0AAW6HUM6 |
| Organism | Xylella fastidiosa subsp. multiplex strain BB08-1 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 700175..732004 | 710890..711336 | within | 0 |
Gene organization within MGE regions
Location: 700175..732004
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KBP48_RS02995 (KBP48_02995) | - | 700175..701005 (-) | 831 | WP_004083974.1 | ABC transporter ATP-binding protein | - |
| KBP48_RS03000 (KBP48_03000) | - | 701011..702129 (-) | 1119 | WP_004083972.1 | ABC transporter permease | - |
| KBP48_RS03005 (KBP48_03005) | - | 702239..703501 (+) | 1263 | WP_012337721.1 | threonine/serine exporter family protein | - |
| KBP48_RS03010 (KBP48_03010) | - | 704142..704348 (+) | 207 | WP_071869858.1 | hypothetical protein | - |
| KBP48_RS03015 (KBP48_03015) | - | 704412..704624 (+) | 213 | WP_228304324.1 | hypothetical protein | - |
| KBP48_RS03020 (KBP48_03020) | - | 704688..704897 (+) | 210 | WP_225621843.1 | hypothetical protein | - |
| KBP48_RS03025 (KBP48_03025) | - | 705535..705762 (-) | 228 | WP_140189681.1 | hypothetical protein | - |
| KBP48_RS03030 (KBP48_03030) | - | 705844..706506 (+) | 663 | WP_011098180.1 | hypothetical protein | - |
| KBP48_RS03035 (KBP48_03035) | - | 706503..707957 (+) | 1455 | WP_004089759.1 | class I SAM-dependent methyltransferase | - |
| KBP48_RS11720 | - | 708111..708236 (+) | 126 | WP_256626233.1 | hypothetical protein | - |
| KBP48_RS03040 (KBP48_03040) | - | 708437..708844 (-) | 408 | WP_038227959.1 | hypothetical protein | - |
| KBP48_RS03045 (KBP48_03045) | - | 708911..709114 (-) | 204 | WP_038227961.1 | DUF4102 domain-containing protein | - |
| KBP48_RS03050 (KBP48_03050) | - | 709424..710596 (-) | 1173 | WP_038210388.1 | integrase | - |
| KBP48_RS03055 (KBP48_03055) | - | 710596..710868 (-) | 273 | WP_004083966.1 | hypothetical protein | - |
| KBP48_RS03060 (KBP48_03060) | ssb | 710890..711336 (-) | 447 | WP_038210386.1 | single-stranded DNA-binding protein | Machinery gene |
| KBP48_RS03065 (KBP48_03065) | - | 711320..711790 (-) | 471 | WP_071869857.1 | DUF5131 family protein | - |
| KBP48_RS03070 (KBP48_03070) | - | 711783..712013 (-) | 231 | WP_154415128.1 | hypothetical protein | - |
| KBP48_RS11385 | - | 712013..712336 (-) | 324 | WP_247644613.1 | hypothetical protein | - |
| KBP48_RS03080 (KBP48_03080) | - | 712429..712962 (-) | 534 | WP_081364569.1 | pilin | - |
| KBP48_RS03085 (KBP48_03085) | - | 713095..713361 (-) | 267 | WP_027700596.1 | hypothetical protein | - |
| KBP48_RS03090 (KBP48_03090) | - | 713358..713636 (-) | 279 | WP_038231409.1 | hypothetical protein | - |
| KBP48_RS03095 (KBP48_03095) | - | 713633..713854 (-) | 222 | WP_021358638.1 | hypothetical protein | - |
| KBP48_RS03100 (KBP48_03100) | - | 713851..714300 (-) | 450 | WP_038210363.1 | hypothetical protein | - |
| KBP48_RS03105 (KBP48_03105) | - | 714300..714758 (-) | 459 | WP_140189684.1 | DUF1566 domain-containing protein | - |
| KBP48_RS03110 (KBP48_03110) | - | 714755..715096 (-) | 342 | WP_228762220.1 | hypothetical protein | - |
| KBP48_RS11390 | - | 715277..715624 (+) | 348 | WP_234499903.1 | CHC2 zinc finger domain-containing protein | - |
| KBP48_RS03120 (KBP48_03120) | - | 715560..716204 (+) | 645 | WP_247644614.1 | terminase gpA endonuclease subunit | - |
| KBP48_RS03125 (KBP48_03125) | - | 716281..716517 (+) | 237 | WP_038228002.1 | hypothetical protein | - |
| KBP48_RS03130 (KBP48_03130) | - | 716514..717029 (+) | 516 | WP_140189685.1 | phage portal protein | - |
| KBP48_RS03135 (KBP48_03135) | - | 717146..717436 (+) | 291 | WP_076613257.1 | hypothetical protein | - |
| KBP48_RS03140 (KBP48_03140) | - | 717561..717989 (-) | 429 | WP_247644615.1 | hypothetical protein | - |
| KBP48_RS03145 (KBP48_03145) | - | 717989..719200 (-) | 1212 | WP_140189686.1 | hypothetical protein | - |
| KBP48_RS03150 (KBP48_03150) | - | 719204..719959 (-) | 756 | WP_140189687.1 | hypothetical protein | - |
| KBP48_RS03155 (KBP48_03155) | - | 720009..720227 (-) | 219 | WP_234499931.1 | hypothetical protein | - |
| KBP48_RS03160 (KBP48_03160) | - | 720224..720619 (-) | 396 | WP_247644616.1 | hypothetical protein | - |
| KBP48_RS03165 (KBP48_03165) | - | 720618..721832 (+) | 1215 | WP_247644617.1 | P22 phage major capsid protein family protein | - |
| KBP48_RS03170 (KBP48_03170) | - | 721836..722243 (+) | 408 | WP_071869998.1 | hypothetical protein | - |
| KBP48_RS03175 (KBP48_03175) | - | 722240..723442 (+) | 1203 | WP_247644618.1 | packaged DNA stabilization protein | - |
| KBP48_RS03180 (KBP48_03180) | - | 723487..724113 (+) | 627 | WP_140160998.1 | IS607 family transposase | - |
| KBP48_RS03185 (KBP48_03185) | - | 724113..725129 (+) | 1017 | Protein_614 | RNA-guided endonuclease TnpB family protein | - |
| KBP48_RS03190 (KBP48_03190) | - | 725211..726512 (-) | 1302 | WP_247644619.1 | portal protein | - |
| KBP48_RS03195 (KBP48_03195) | - | 726515..727900 (-) | 1386 | WP_247644620.1 | terminase family protein | - |
| KBP48_RS03200 (KBP48_03200) | - | 727839..728165 (-) | 327 | WP_140189688.1 | hypothetical protein | - |
| KBP48_RS03205 (KBP48_03205) | - | 728165..728422 (-) | 258 | WP_171946801.1 | hypothetical protein | - |
| KBP48_RS03210 (KBP48_03210) | - | 728901..729254 (-) | 354 | WP_071870005.1 | hypothetical protein | - |
| KBP48_RS03215 (KBP48_03215) | - | 729256..729483 (-) | 228 | WP_247644621.1 | phage holin family protein | - |
| KBP48_RS03220 (KBP48_03220) | - | 729569..730195 (+) | 627 | WP_140189401.1 | IS607 family transposase | - |
| KBP48_RS03225 (KBP48_03225) | - | 730189..731421 (+) | 1233 | WP_140160997.1 | RNA-guided endonuclease TnpB family protein | - |
| KBP48_RS03230 (KBP48_03230) | - | 731438..732004 (-) | 567 | WP_004085755.1 | recombinase family protein | - |
Sequence
Protein
Download Length: 148 a.a. Molecular weight: 16508.32 Da Isoelectric Point: 6.4865
>NTDB_id=556889 KBP48_RS03060 WP_038210386.1 710890..711336(-) (ssb) [Xylella fastidiosa subsp. multiplex strain BB08-1]
MARGINKVILVGNLGNEPDIKYTQSGMTITSISLATSSGRKDREGNTQERTEWHRVKFFGKLGEIAAEYLHKGSQCYIEG
TIRYDKFTGNDGQDRYVTEIIADQMHMLGGRGEGSSGITPQRQPAKVRNNDKAYAYAGDDFHDDDIPF
MARGINKVILVGNLGNEPDIKYTQSGMTITSISLATSSGRKDREGNTQERTEWHRVKFFGKLGEIAAEYLHKGSQCYIEG
TIRYDKFTGNDGQDRYVTEIIADQMHMLGGRGEGSSGITPQRQPAKVRNNDKAYAYAGDDFHDDDIPF
Nucleotide
Download Length: 447 bp
>NTDB_id=556889 KBP48_RS03060 WP_038210386.1 710890..711336(-) (ssb) [Xylella fastidiosa subsp. multiplex strain BB08-1]
ATGGCACGCGGAATTAACAAGGTGATCCTAGTCGGCAACCTGGGGAACGAACCGGATATCAAATACACCCAAAGCGGCAT
GACGATCACCAGCATTAGCCTAGCGACCAGCAGCGGACGCAAGGACAGAGAGGGCAATACCCAGGAGCGGACCGAATGGC
ACCGCGTCAAGTTTTTCGGAAAGCTGGGCGAGATTGCCGCCGAATATCTGCATAAGGGATCGCAGTGCTACATAGAGGGC
ACCATCCGTTACGACAAGTTCACCGGCAATGATGGCCAGGACCGTTATGTCACTGAGATTATTGCTGACCAAATGCACAT
GCTCGGCGGTCGCGGTGAAGGCTCCAGCGGTATCACGCCACAGCGGCAACCGGCAAAGGTCCGTAACAACGATAAAGCCT
ATGCGTATGCAGGCGACGACTTCCACGATGACGACATCCCGTTTTAG
ATGGCACGCGGAATTAACAAGGTGATCCTAGTCGGCAACCTGGGGAACGAACCGGATATCAAATACACCCAAAGCGGCAT
GACGATCACCAGCATTAGCCTAGCGACCAGCAGCGGACGCAAGGACAGAGAGGGCAATACCCAGGAGCGGACCGAATGGC
ACCGCGTCAAGTTTTTCGGAAAGCTGGGCGAGATTGCCGCCGAATATCTGCATAAGGGATCGCAGTGCTACATAGAGGGC
ACCATCCGTTACGACAAGTTCACCGGCAATGATGGCCAGGACCGTTATGTCACTGAGATTATTGCTGACCAAATGCACAT
GCTCGGCGGTCGCGGTGAAGGCTCCAGCGGTATCACGCCACAGCGGCAACCGGCAAAGGTCCGTAACAACGATAAAGCCT
ATGCGTATGCAGGCGACGACTTCCACGATGACGACATCCCGTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
41.477 |
100 |
0.493 |
| ssb | Neisseria meningitidis MC58 |
38.15 |
100 |
0.446 |
| ssb | Neisseria gonorrhoeae MS11 |
38.15 |
100 |
0.446 |
| ssb | Glaesserella parasuis strain SC1401 |
41.304 |
93.243 |
0.385 |