Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   J9B93_RS11755 Genome accession   NZ_CP072843
Coordinates   2456457..2456834 (-) Length   125 a.a.
NCBI ID   WP_014305410.1    Uniprot ID   -
Organism   Bacillus velezensis strain VY03     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2451457..2461834
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  J9B93_RS11715 (J9B93_11715) - 2451956..2452750 (+) 795 WP_003153106.1 YqhG family protein -
  J9B93_RS11720 (J9B93_11720) sinI 2452927..2453100 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  J9B93_RS11725 (J9B93_11725) sinR 2453134..2453469 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  J9B93_RS11730 (J9B93_11730) tasA 2453517..2454302 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  J9B93_RS11735 (J9B93_11735) sipW 2454366..2454950 (-) 585 WP_012117977.1 signal peptidase I SipW -
  J9B93_RS11740 (J9B93_11740) tapA 2454922..2455593 (-) 672 WP_063174755.1 amyloid fiber anchoring/assembly protein TapA -
  J9B93_RS11745 (J9B93_11745) - 2455852..2456181 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  J9B93_RS11750 (J9B93_11750) - 2456221..2456400 (-) 180 WP_003153093.1 YqzE family protein -
  J9B93_RS11755 (J9B93_11755) comGG 2456457..2456834 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  J9B93_RS11760 (J9B93_11760) comGF 2456835..2457230 (-) 396 WP_095318401.1 competence type IV pilus minor pilin ComGF -
  J9B93_RS11765 (J9B93_11765) comGE 2457244..2457558 (-) 315 WP_041481885.1 competence type IV pilus minor pilin ComGE Machinery gene
  J9B93_RS11770 (J9B93_11770) comGD 2457542..2457979 (-) 438 WP_095318402.1 competence type IV pilus minor pilin ComGD Machinery gene
  J9B93_RS11775 (J9B93_11775) comGC 2457969..2458235 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  J9B93_RS11780 (J9B93_11780) comGB 2458282..2459319 (-) 1038 WP_095318403.1 competence type IV pilus assembly protein ComGB Machinery gene
  J9B93_RS11785 (J9B93_11785) comGA 2459306..2460376 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  J9B93_RS11790 (J9B93_11790) - 2460568..2461518 (-) 951 WP_014305415.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14170.14 Da        Isoelectric Point: 9.9592

>NTDB_id=556107 J9B93_RS11755 WP_014305410.1 2456457..2456834(-) (comGG) [Bacillus velezensis strain VY03]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FRITGSDRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=556107 J9B93_RS11755 WP_014305410.1 2456457..2456834(-) (comGG) [Bacillus velezensis strain VY03]
ATGTACAAATCTGACGGTTTTATCTATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCGCATCACCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512