Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   J9B93_RS11720 Genome accession   NZ_CP072843
Coordinates   2452927..2453100 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain VY03     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2447927..2458100
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  J9B93_RS11705 (J9B93_11705) gcvT 2448745..2449845 (-) 1101 WP_069473502.1 glycine cleavage system aminomethyltransferase GcvT -
  J9B93_RS11710 (J9B93_11710) - 2450268..2451938 (+) 1671 WP_003153107.1 DEAD/DEAH box helicase -
  J9B93_RS11715 (J9B93_11715) - 2451956..2452750 (+) 795 WP_003153106.1 YqhG family protein -
  J9B93_RS11720 (J9B93_11720) sinI 2452927..2453100 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  J9B93_RS11725 (J9B93_11725) sinR 2453134..2453469 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  J9B93_RS11730 (J9B93_11730) tasA 2453517..2454302 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  J9B93_RS11735 (J9B93_11735) sipW 2454366..2454950 (-) 585 WP_012117977.1 signal peptidase I SipW -
  J9B93_RS11740 (J9B93_11740) tapA 2454922..2455593 (-) 672 WP_063174755.1 amyloid fiber anchoring/assembly protein TapA -
  J9B93_RS11745 (J9B93_11745) - 2455852..2456181 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  J9B93_RS11750 (J9B93_11750) - 2456221..2456400 (-) 180 WP_003153093.1 YqzE family protein -
  J9B93_RS11755 (J9B93_11755) comGG 2456457..2456834 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  J9B93_RS11760 (J9B93_11760) comGF 2456835..2457230 (-) 396 WP_095318401.1 competence type IV pilus minor pilin ComGF -
  J9B93_RS11765 (J9B93_11765) comGE 2457244..2457558 (-) 315 WP_041481885.1 competence type IV pilus minor pilin ComGE Machinery gene
  J9B93_RS11770 (J9B93_11770) comGD 2457542..2457979 (-) 438 WP_095318402.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=556105 J9B93_RS11720 WP_003153105.1 2452927..2453100(+) (sinI) [Bacillus velezensis strain VY03]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=556105 J9B93_RS11720 WP_003153105.1 2452927..2453100(+) (sinI) [Bacillus velezensis strain VY03]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702