Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   J8615_RS12525 Genome accession   NZ_CP072791
Coordinates   2561348..2561785 (-) Length   145 a.a.
NCBI ID   WP_044053464.1    Uniprot ID   -
Organism   Bacillus velezensis strain GS-1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2556348..2566785
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  J8615_RS12475 (J8615_12465) sinI 2556733..2556906 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  J8615_RS12480 (J8615_12470) sinR 2556940..2557275 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  J8615_RS12485 (J8615_12475) tasA 2557323..2558108 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  J8615_RS12490 (J8615_12480) sipW 2558172..2558756 (-) 585 WP_046559873.1 signal peptidase I SipW -
  J8615_RS12495 (J8615_12485) tapA 2558728..2559399 (-) 672 WP_046559874.1 amyloid fiber anchoring/assembly protein TapA -
  J8615_RS12500 (J8615_12490) - 2559658..2559987 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  J8615_RS12505 (J8615_12495) - 2560027..2560206 (-) 180 WP_003153093.1 YqzE family protein -
  J8615_RS12510 (J8615_12500) comGG 2560263..2560640 (-) 378 WP_046559875.1 competence type IV pilus minor pilin ComGG Machinery gene
  J8615_RS12515 (J8615_12505) comGF 2560641..2561036 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  J8615_RS12520 (J8615_12510) comGE 2561050..2561364 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  J8615_RS12525 (J8615_12515) comGD 2561348..2561785 (-) 438 WP_044053464.1 competence type IV pilus minor pilin ComGD Machinery gene
  J8615_RS12530 (J8615_12520) comGC 2561775..2562083 (-) 309 WP_219984632.1 competence type IV pilus major pilin ComGC Machinery gene
  J8615_RS12535 (J8615_12525) comGB 2562088..2563125 (-) 1038 WP_014305414.1 competence type IV pilus assembly protein ComGB Machinery gene
  J8615_RS12540 (J8615_12530) comGA 2563112..2564182 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  J8615_RS12545 (J8615_12535) - 2564374..2565324 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -
  J8615_RS12550 (J8615_12540) - 2565470..2566771 (+) 1302 WP_014305416.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16282.81 Da        Isoelectric Point: 10.3354

>NTDB_id=555840 J8615_RS12525 WP_044053464.1 2561348..2561785(-) (comGD) [Bacillus velezensis strain GS-1]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIRLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=555840 J8615_RS12525 WP_044053464.1 2561348..2561785(-) (comGD) [Bacillus velezensis strain GS-1]
TTGAACAATAACAGGCGGACAGAAAACGGGTTTACTCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTTCAAAAAGATA
TTCAGCTTGCGCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGTAGGATTGTCGAGCGTTCTTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCGATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.164

100

0.566